• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PHOSPHO1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138225

Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PHOSPHO1, Monoclonal Antibody
Full Product Name
PHOSPHO1 (Phosphoethanolamine/Phosphocholine Phosphatase) APC
Product Gene Name
anti-PHOSPHO1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B2
Host
Mouse
Species Reactivity
Human, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PHOSPHO1. Species Crossreactivity: rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
32.2 kDa (291aa) confirmed by MALDI-TOF
3D Structure
ModBase 3D Structure for Q8TCT1
Immunogen
Partial recombinant protein corresponding to aa168-267 from human PHOSPHO1 (NP_848595) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS
Conjugate
APC

Product Categories/Family for anti-PHOSPHO1 antibody

Antibodies; Enzymes; Phosphatase
Applications Tested/Suitable for anti-PHOSPHO1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PHOSPHO1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PHOSPHO1 antibody

Western Blot detection against Immunogen (37kD).
Mouse Anti-PHOSPHO1 Monoclonal Antibody – Cat# MBS6138225

Western Blot (WB) of anti-PHOSPHO1 antibody

PHOSPHO1 monoclonal antibody. Western Blot analysis of PHOSPHO1 expression in PC-12.
Mouse Anti-PHOSPHO1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6138225

Western Blot (WB) of anti-PHOSPHO1 antibody

PHOSPHO1 monoclonal antibody Western Blot analysis of PHOSPHO1 expression in Jurkat.
Mouse Anti-PHOSPHO1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6138225

Testing Data of anti-PHOSPHO1 antibody

Detection limit for recombinant GST tagged PHOSPHO1 is ~1ng/ml as a capture antibody.
Mouse Anti-PHOSPHO1 Monoclonal Antibody, Testing Data – Cat# MBS6138225

Other Notes

Small volumes of anti-PHOSPHO1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PHOSPHO1 purchase

MBS6138225 is an antibody targeting PHOSPHO1. Also known as PHOSPHO1 (Phosphoethanolamine/Phosphocholine Phosphatase) APC. Reactive in Human, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PHOSPHO1. It may not necessarily be applicable to this product.

NCBI GI #
30425420
NCBI GeneID
162466
NCBI Accession #
NP_848595
UniProt Primary Accession #
Q8TCT1
UniProt Secondary Accession #
Q17RU6; E9PAM0
UniProt Related Accession #
Q8TCT1
GenBank Nucleotide #
NM_178500
NCBI Official Full Name
phosphoethanolamine/phosphocholine phosphatase isoform 2
NCBI Official Synonym Full Names
phosphoethanolamine/phosphocholine phosphatase
NCBI Official Symbol
PHOSPHO1
UniProt Protein Name
Phosphoethanolamine/phosphocholine phosphatase
Protein Family
Phosphoethanolamine/phosphocholine phosphatase
UniProt Gene Name
PHOSPHO1
UniProt Entry Name
PHOP1_HUMAN
NCBI Protein Information
phosphoethanolamine/phosphocholine phosphatase

UniProt Comments for PHOSPHO1

PHOSPHO1: Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization. Belongs to the HAD-like hydrolase superfamily. PHOSPHO family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphatase; EC 3.1.3.75; Lipid Metabolism - glycerophospholipid

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cytosol

Molecular Function: pyrophosphatase activity; metal ion binding; phosphoric monoester hydrolase activity

Biological Process: dephosphorylation; phospholipid metabolic process; phosphatidylethanolamine biosynthetic process; glycerophospholipid biosynthetic process; phosphatidylcholine biosynthetic process; regulation of bone mineralization; endochondral ossification
Show more

Research Articles on PHOSPHO1

1. DNA methylation at the PHOSPHO1 locus cg02650017 in blood DNA was associated with a decreased risk for future type 2 diabetes.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PHOSPHO1 antibody

 Products by Pathway  Pathway Diagram
 Glycerophospholipid Biosynthesis Pathway antibodies  Glycerophospholipid Biosynthesis Pathway Diagram
 Glycerophospholipid Metabolism Pathway antibodies  Glycerophospholipid Metabolism Pathway Diagram
 Glycerophospholipid Metabolism Pathway antibodies  Glycerophospholipid Metabolism Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 Phospholipid Metabolism Pathway antibodies  Phospholipid Metabolism Pathway Diagram
 Synthesis Of PC Pathway antibodies  Synthesis Of PC Pathway Diagram
 Synthesis Of PE Pathway antibodies  Synthesis Of PE Pathway Diagram

Organs/Tissues associated with anti-PHOSPHO1 antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >22 publications with PHOSPHO1 and Bone
 Embryonic Tissue Antibodies  >5 publications with PHOSPHO1 and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000