• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PI4KB Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138237

Phosphoinositides are pivotal precursors to important second messengers and as signaling and molecules. Phosphatidylinositol 4-kinases (PI4Ks) are are crucial regulators of the phosphoinsitide cascade. PI4KCB is a wortmannin-sensitive PI 4-kinase responsible… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PI4KB, Monoclonal Antibody
Full Product Name
PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) APC
Product Gene Name
anti-PI4KB antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PIK4CB.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
93kDa
OMIM
602758
3D Structure
ModBase 3D Structure for Q9UBF8
Immunogen
Partial recombinant corresponding to aa731-829 from human PIK4CB (NP_002642) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Conjugate
APC

Product Categories/Family for anti-PI4KB antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-PI4KB antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PI4KB antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PI4KB antibody

Western Blot detection against Immunogen (36.52kD).
Mouse Anti-PI4KB Monoclonal Antibody – Cat# MBS6138237

Testing Data of anti-PI4KB antibody

Detection limit for recombinant GST tagged PIK4CB is ~3ng/ml as a capture antibody.
Mouse Anti-PI4KB Monoclonal Antibody, Testing Data – Cat# MBS6138237

Other Notes

Small volumes of anti-PI4KB antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PI4KB purchase

MBS6138237 is an antibody targeting PI4KB. Also known as PI4KB (PIK4CB, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4Kbeta, PtdIns 4-kinase beta, NPIK, PI4K92) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PI4KB. It may not necessarily be applicable to this product.

NCBI GI #
4505809
NCBI GeneID
5298
NCBI Accession #
NP_002642
UniProt Primary Accession #
Q9UBF8
UniProt Related Accession #
Q9UBF8
GenBank Nucleotide #
NM_002651
NCBI Official Full Name
phosphatidylinositol 4-kinase beta isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol 4-kinase beta
NCBI Official Symbol
PI4KB
NCBI Official Synonym Symbols
NPIK; PI4K92; PIK4CB; PI4KBETA; PI4K-BETA; PI4KIIIBETA
UniProt Protein Name
Phosphatidylinositol 4-kinase beta
UniProt Synonym Protein Names
NPIK; PI4K92
Protein Family
Phosphatidylinositol 4-kinase
UniProt Gene Name
PI4KB
UniProt Synonym Gene Names
PIK4CB; PI4K-beta; PI4Kbeta
UniProt Entry Name
PI4KB_HUMAN
NCBI Protein Information
phosphatidylinositol 4-kinase beta

UniProt Comments for PI4KB

PIK4CB: a member of the PI3/PI4 kinase family. Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol- 1,4,5,-trisphosphate. Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-biphosphate (PIP2) on the Golgi complex. May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Three splice-variant isoforms have been described.

Protein type: Kinase, lipid; EC 2.7.1.67; Motility/polarity/chemotaxis; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: Golgi membrane; mitochondrial outer membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; rough endoplasmic reticulum membrane; cytosol; endosome

Molecular Function: 1-phosphatidylinositol 4-kinase activity; protein binding; ATP binding

Biological Process: receptor-mediated endocytosis; phosphoinositide-mediated signaling; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; signal transduction
Show more

Research Articles on PI4KB

1. PI4KIIIbeta interaction with the VHS domain of GGA2 affected PI4KIIIbeta localization.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000