• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PTPLAD1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138521

MBS6138521 is an antibody targeting PTPLAD1. Also known as PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1, Protein Tyrosine Phosphatase-like Protein PTPLAD1, Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3,… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PTPLAD1, Monoclonal Antibody
Full Product Name
PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1, Protein Tyrosine Phosphatase-like Protein PTPLAD1, Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3, 3-hydroxyacyl-CoA Dehydratase 3, HACD3, Butyrate-induced
Product Gene Name
anti-PTPLAD1 antibody
Product Synonym Names
EC=4.2.1.134; FLJ90376
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PTPLAD1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
43kDa
3D Structure
ModBase 3D Structure for Q9P035
Immunogen
Partial recombinant corresponding to aa1-114 from human PTPLAD1 (NP_057479) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE
Conjugate
APC

Product Categories/Family for anti-PTPLAD1 antibody

Antibodies; Enzymes; Phosphatase
Applications Tested/Suitable for anti-PTPLAD1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-PTPLAD1 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PTPLAD1 antibody

Western Blot detection against Immunogen (38.54kD).
Mouse Anti-PTPLAD1 Monoclonal Antibody – Cat# MBS6138521

Immunofluorescence (IF) of anti-PTPLAD1 antibody

Immunofluorescence of monoclonal antibody to PTPLAD1 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-PTPLAD1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6138521

Other Notes

Small volumes of anti-PTPLAD1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PTPLAD1. It may not necessarily be applicable to this product.

NCBI GI #
117168248
NCBI GeneID
51495
NCBI Accession #
NP_057479
UniProt Primary Accession #
Q9P035
UniProt Related Accession #
Q9P035
GenBank Nucleotide #
NM_016395
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
NCBI Official Synonym Full Names
3-hydroxyacyl-CoA dehydratase 3
NCBI Official Symbol
HACD3
NCBI Official Synonym Symbols
BIND1; B-IND1; HSPC121; PTPLAD1
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3
UniProt Synonym Protein Names
3-hydroxyacyl-CoA dehydratase 3; HACD3; Butyrate-induced protein 1; B-ind1; hB-ind1; Protein tyrosine phosphatase-like protein PTPLAD1; Protein-tyrosine phosphatase-like A domain-containing protein 1
UniProt Gene Name
PTPLAD1
UniProt Synonym Gene Names
BIND1; HACD3; HACD3; B-ind1; hB-ind1
UniProt Entry Name
HACD3_HUMAN
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

UniProt Comments for PTPLAD1

Function: Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. Involved in Rac1-signaling pathways leading to the modulation of gene expression. Ref.1 Ref.8

Catalytic activity: A very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] = a very-long-chain trans-2,3-dehydroacyl-[acyl-carrier protein] + H2O. Ref.8

Subunit structure: Interacts with the condensation enzymes of the ELOVL family. Interacts with RAC1. Ref.1 Ref.8

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.8.

Tissue specificity: Highly expressed in testis, kidney, brain, liver and weakly in skeletal muscle, spleen and heart. No expression detected in leukocytes. Ref.1 Ref.8

Induction: By AKAP12 and histone deacetylase inhibitors such as sodium butyrate. Ref.6

Sequence similarities: Belongs to the very long-chain fatty acids dehydratase HACD family.Contains 1 CS domain.

Sequence caution: The sequence AAF29085.1 differs from that shown. Reason: Frameshift at position 356. The sequence BAC11249.1 differs from that shown. Reason: Frameshift at position 359.
Show more

Research Articles on PTPLAD1

1. HACD3 (PTPLAD1) is a new candidate gene for type-2 diabetes risk. HACD3 deletion decreases the autophosphorylation of insulin receptor in vitro. HACD3 may regulate the activity of CDK2 and RAB5C.Overexpression of HACD3 inhibits the tyrosine phosphorylation of CDK2 and RAB5C. HACD3 stimulates the physical association of insulin receptor with RAB11A and may regulate the recycling of insulin receptor to the plasma membrane.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PTPLAD1 antibody

 Reference Product  PubMed Publications
 RAC1 antibody  >1 publications with PTPLAD1 and RAC1

Diseases associated with anti-PTPLAD1 antibody

 Disease Name  Pubmed Publications
 Breast Neoplasms Antibodies  >1 publications with PTPLAD1 and Breast Neoplasms
 Neoplasms Antibodies  >1 publications with PTPLAD1 and Neoplasms
 Kidney Diseases Antibodies  >1 publications with PTPLAD1 and Kidney Diseases
 Hypertrophy Antibodies  >1 publications with PTPLAD1 and Hypertrophy
 Liver Diseases Antibodies  >1 publications with PTPLAD1 and Liver Diseases

Organs/Tissues associated with anti-PTPLAD1 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >2 publications with PTPLAD1 and Muscle
 Heart Antibodies  >1 publications with PTPLAD1 and Heart
 Blood Antibodies  >1 publications with PTPLAD1 and Blood
 Prostate Antibodies  >1 publications with PTPLAD1 and Prostate
 Liver Antibodies  >1 publications with PTPLAD1 and Liver
 Kidney Antibodies  >1 publications with PTPLAD1 and Kidney
 Uncharacterized Tissue Antibodies  >1 publications with PTPLAD1 and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000