• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RAB7B Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138576

MBS6138576 is an antibody targeting RAB7B. Also known as RAB7B (Ras-related Protein Rab-7b, RAB7) APC. Reactive in Human. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RAB7B, Monoclonal Antibody
Full Product Name
RAB7B (Ras-related Protein Rab-7b, RAB7) APC
Product Gene Name
anti-RAB7B antibody
Product Synonym Names
MGC16212; MGC9726
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RAB7B.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
3D Structure
ModBase 3D Structure for Q96AH8
Immunogen
Partial recombinant protein corresponding to aa100-200 from human RAB7B (NP_796377) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC*
Conjugate
APC

Product Categories/Family for anti-RAB7B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins
Applications Tested/Suitable for anti-RAB7B antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-RAB7B antibody
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RAB7B antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-RAB7B Monoclonal Antibody – Cat# MBS6138576

Western Blot (WB) of anti-RAB7B antibody

RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in human kidney.
Mouse Anti-RAB7B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6138576

Western Blot (WB) of anti-RAB7B antibody

Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody. Lane 1: RAB7B transfected lysate (22.5kD). Lane 2: Non-transfected lysate.
Mouse Anti-RAB7B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6138576

Immunoprecipitation (IP) of anti-RAB7B antibody

Immunoprecipitation of RAB7B transfected lysate using RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B rabbit polyclonal antibody.
Mouse Anti-RAB7B Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6138576

Testing Data of anti-RAB7B antibody

Detection limit for recombinant GST tagged RAB7B is ~0.03ng/ml as a capture antibody.
Mouse Anti-RAB7B Monoclonal Antibody, Testing Data – Cat# MBS6138576

Western Blot (WB) of anti-RAB7B antibody

RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in A-431.
Mouse Anti-RAB7B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6138576

Product References and Citations for anti-RAB7B antibody

1. Zlatic SA, Tornieri K, L'hernault SW, Faundez V.Mol Biol Cell. 2011 May;22(10):1699-715. Epub 2011 Mar 16. 2. Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E.J Neuropathol Exp Neurol. 2009 Sep;68(9):994-1005. 3.GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K.J Neurochem. 2010 Jul 28. 4. Zhu GD, Salazar G, Zlatic SA, Fiza B, Doucette MM, Heilman CJ, Levey AI, Faundez V, L'hernault SW.Mol Biol Cell. 2009 Feb;20(4):1223-1240. Epub 2008 Dec 24.

Other Notes

Small volumes of anti-RAB7B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RAB7B. It may not necessarily be applicable to this product.

NCBI GI #
256985158
NCBI GeneID
338382
NCBI Accession #
NP_796377
UniProt Primary Accession #
Q96AH8
UniProt Related Accession #
Q96AH8
GenBank Nucleotide #
NM_177403
NCBI Official Full Name
ras-related protein Rab-7b isoform a
NCBI Official Synonym Full Names
RAB7B, member RAS oncogene family
NCBI Official Symbol
RAB7B
NCBI Official Synonym Symbols
RAB7
UniProt Protein Name
Ras-related protein Rab-7b
Protein Family
Ras-related protein
UniProt Gene Name
RAB7B
UniProt Entry Name
RAB7B_HUMAN
NCBI Protein Information
ras-related protein Rab-7b

UniProt Comments for RAB7B

RAB7B: Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: Golgi apparatus; phagocytic vesicle membrane; lysosome; late endosome; trans-Golgi network; phagocytic vesicle

Molecular Function: GTP binding

Biological Process: negative regulation of toll-like receptor 9 signaling pathway; protein transport; small GTPase mediated signal transduction; negative regulation of toll-like receptor 4 signaling pathway; positive regulation of interleukin-6 production; positive regulation of megakaryocyte differentiation; activation of NF-kappaB transcription factor
Show more

Research Articles on RAB7B

1. TBC1D5 is a GAP for Rab7b in the control of endosomal transport to the trans-Golgi.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-RAB7B antibody

 Products by Pathway  Pathway Diagram
 Amoebiasis Pathway antibodies  Amoebiasis Pathway Diagram
 Amoebiasis Pathway antibodies  Amoebiasis Pathway Diagram
 Phagosome Pathway antibodies  Phagosome Pathway Diagram
 Phagosome Pathway antibodies  Phagosome Pathway Diagram
 Salmonella Infection Pathway antibodies  Salmonella Infection Pathway Diagram
 Salmonella Infection Pathway antibodies  Salmonella Infection Pathway Diagram

Organs/Tissues associated with anti-RAB7B antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >4 publications with RAB7B and Brain
 Lung Antibodies  >2 publications with RAB7B and Lung
 Heart Antibodies  >1 publications with RAB7B and Heart
 Placenta Antibodies  >1 publications with RAB7B and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000