• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SHC Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6139041

MBS6139041 is an antibody targeting SHC. Also known as SHC (SHC-transforming Protein 1, SH2 Domain Protein C1, SHC1, SHC-transforming Protein 3, SHC-transforming Protein A, SHCA, Src Homology 2 Domain-containing-transforming Protein C1, FLJ26504) APC.… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SHC, Monoclonal Antibody
Full Product Name
SHC (SHC-transforming Protein 1, SH2 Domain Protein C1, SHC1, SHC-transforming Protein 3, SHC-transforming Protein A, SHCA, Src Homology 2 Domain-containing-transforming Protein C1, FLJ26504) APC
Product Gene Name
anti-SHC antibody
Clonality
Monoclonal
Isotype
IgG
Clone Number
3F4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SHC1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa171-280 from human SHC1 (AAH33925) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
Conjugate
APC

Product Categories/Family for anti-SHC antibody

Antibodies; Adapter Proteins
Applications Tested/Suitable for anti-SHC antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-SHC antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SHC antibody

Western Blot detection against Immunogen (38.1kD).
Mouse Anti-SHC Monoclonal Antibody – Cat# MBS6139041

Western Blot (WB) of anti-SHC antibody

SHC1 monoclonal antibody, Western Blot analysis of SHC1 expression in A-431.
Mouse Anti-SHC Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139041

Immunohistochemistry (IHC) of anti-SHC antibody

Immunoperoxidase of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1ug/ml].
Mouse Anti-SHC Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6139041

Immunofluorescence (IF) of anti-SHC antibody

Immunofluorescence of monoclonal antibody to SHC1 on A-431 cell. [antibody concentration 10ug/ml].
Mouse Anti-SHC Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6139041

Testing Data of anti-SHC antibody

Detection limit for recombinant GST tagged SHC1 is ~0.03ng/ml as a capture antibody.
Mouse Anti-SHC Monoclonal Antibody, Testing Data – Cat# MBS6139041

Testing Data of anti-SHC antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between PIK3R1 and SHC1 HeLa cells were stained with PIK3R1 rabbit purified polyclonal 1:1200 and SHC1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-SHC Monoclonal Antibody, Testing Data – Cat# MBS6139041

Testing Data of anti-SHC antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between PIK3R1 and SHC1 Huh7 cells were stained with PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-SHC Monoclonal Antibody, Testing Data – Cat# MBS6139041

Other Notes

Small volumes of anti-SHC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SHC. It may not necessarily be applicable to this product.

NCBI GI #
21706899
NCBI GeneID
6464
NCBI Accession #
BC033925
NCBI Related Accession #
AAH33925
UniProt Related Accession #
P29353
NCBI Official Full Name
Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1, mRNA
NCBI Official Synonym Full Names
SHC adaptor protein 1
NCBI Official Symbol
SHC1
NCBI Official Synonym Symbols
SHC; SHCA
Protein Family
Probable squalene--hopene cyclase
NCBI Protein Information
SHC-transforming protein 1

NCBI Summary for SHC

This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen species. The other two isoforms, p52Shc and p46Shc, link activated receptor tyrosine kinases to the Ras pathway by recruitment of the GRB2/SOS complex. p66Shc is not involved in Ras activation. Unlike the other two isoforms, p46Shc is targeted to the mitochondrial matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
Show more

Research Articles on SHC

1. In B cell lymphoma cells, reactive oxygen species production promoted p66shc expression, induced DNA damage, and facilitated cell apoptosis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000