• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SLK Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6139153

MBS6139153 is an antibody targeting SLK. Also known as SLK (STE20-like Serine/threonine-protein Kinase, STE20-like Kinase, hSLK, CTCL Tumor Antigen Se20-9, KIAA0204, STE20-related Serine/threonine-protein Kinase, STE20-related Kinase, Serine/threonine-protein… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SLK, Monoclonal Antibody
Full Product Name
SLK (STE20-like Serine/threonine-protein Kinase, STE20-like Kinase, hSLK, CTCL Tumor Antigen Se20-9, KIAA0204, STE20-related Serine/threonine-protein Kinase, STE20-related Kinase, Serine/threonine-protein Kinase 2, STK2) APC
Product Gene Name
anti-SLK antibody
Product Synonym Names
EC=2.7.11.1; bA16H23.1; LOSK; se20-9
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SLK.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
3D Structure
ModBase 3D Structure for Q9H2G2
Immunogen
Partial recombinant corresponding to aa1126-1235 from SLK (NP_055535) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS
Conjugate
APC

Product Categories/Family for anti-SLK antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-SLK antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-SLK antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SLK antibody

Western Blot detection against Immunogen (37.84kD).
Mouse Anti-SLK Monoclonal Antibody – Cat# MBS6139153

Western Blot (WB) of anti-SLK antibody

SLK monoclonal antibody Western Blot analysis of SLK expression in Hela NE
Mouse Anti-SLK Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139153

Immunohistochemistry (IHC) of anti-SLK antibody

Immunoperoxidase of monoclonal antibody to SLK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml]
Mouse Anti-SLK Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6139153

Other Notes

Small volumes of anti-SLK antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SLK. It may not necessarily be applicable to this product.

NCBI GI #
1519245050
NCBI GeneID
9748
NCBI Accession #
NM_014720.4
UniProt Primary Accession #
Q9H2G2
UniProt Related Accession #
Q9H2G2
GenBank Nucleotide #
NM_014720
NCBI Official Full Name
Homo sapiens STE20 like kinase (SLK), transcript variant 1, mRNA
NCBI Official Synonym Full Names
STE20 like kinase
NCBI Official Symbol
SLK
NCBI Official Synonym Symbols
LOSK; STK2; se20-9; bA16H23.1
UniProt Protein Name
STE20-like serine/threonine-protein kinase
UniProt Synonym Protein Names
CTCL tumor antigen se20-9; STE20-related serine/threonine-protein kinase; STE20-related kinase; Serine/threonine-protein kinase 2
Protein Family
STE20-like serine/threonine-protein kinase
UniProt Gene Name
SLK
UniProt Synonym Gene Names
KIAA0204; STK2; STE20-like kinase; hSLK
UniProt Entry Name
SLK_HUMAN
NCBI Protein Information
STE20-like serine/threonine-protein kinase

UniProt Comments for SLK

SLK: a microtubule-associated protein kinase required for progression through G2. Co-localizes with the mitotic spindle in cells undergoing mitosis. Regulates actin reorganization during cell adhesion and spreading via a Rac1-mediated pathway. Signals via ASK1 and p38 to promote apoptosis. Activated in response to anoxia and ischemia-reperfusion injury in cell culture. It inhibits the protective aspects of the endoplasmic reticulum stress response, thus contributing to its proapoptotic effect. Two alternatively-spliced isoforms have been described.

Protein type: Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; STE group; STE20 family; SLK subfamily

Chromosomal Location of Human Ortholog: 10q24.33

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; identical protein binding; protein homodimerization activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; protein amino acid autophosphorylation
Show more

Research Articles on SLK

1. The inhibition of SLK by RNA interference significantly suppressed the invasion ability of glioma, and on protein level, knock- down of SLK leaded to an up-regulation of E-cadherin and a down-regulation of Vimentin in glioma cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000