• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SSX4 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6139301

MBS6139301 is an antibody targeting SSX4. Also known as SSX4 (SSX4A, Protein SSX4, Cancer/Testis Antigen 5.4, MGC119056, MGC12411) APC. Reactive in Human. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SSX4, Monoclonal Antibody
Full Product Name
SSX4 (SSX4A, Protein SSX4, Cancer/Testis Antigen 5.4, MGC119056, MGC12411) APC
Product Gene Name
anti-SSX4 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SSX4.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
22kDa
OMIM
U90841 mRNA
3D Structure
ModBase 3D Structure for O60224
Immunogen
Partial recombinant corresponding to aa91-189 from human SSX4 (NP_005627) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE*
Conjugate
APC

Product Categories/Family for anti-SSX4 antibody

Antibodies; Cancer Markers
Applications Tested/Suitable for anti-SSX4 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-SSX4 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SSX4 antibody

Western Blot detection against Immunogen (36.89kD).
Mouse Anti-SSX4 Monoclonal Antibody – Cat# MBS6139301

Immunofluorescence (IF) of anti-SSX4 antibody

Immunofluorescence of monoclonal antibody to SSX4 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-SSX4 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6139301

Testing Data of anti-SSX4 antibody

Detection limit for recombinant GST tagged SSX4 is ~3ng/ml as a capture antibody.
Mouse Anti-SSX4 Monoclonal Antibody, Testing Data – Cat# MBS6139301

Other Notes

Small volumes of anti-SSX4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SSX4. It may not necessarily be applicable to this product.

NCBI GI #
5032123
NCBI GeneID
6759
NCBI Accession #
NP_005627
UniProt Primary Accession #
O60224
UniProt Related Accession #
O60224
GenBank Nucleotide #
NM_005636
NCBI Official Full Name
protein SSX4 isoform a
NCBI Official Synonym Full Names
SSX family member 4
NCBI Official Symbol
SSX4
NCBI Official Synonym Symbols
CT5.4
UniProt Protein Name
Protein SSX4
UniProt Synonym Protein Names
Cancer/testis antigen 5.4; CT5.4
Protein Family
Protein
UniProt Gene Name
SSX4
UniProt Synonym Gene Names
SSX4A; CT5.4
NCBI Protein Information
protein SSX4

NCBI Summary for SSX4

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for SSX4

SSX4: Could act as a modulator of transcription. Belongs to the SSX family.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleus

Molecular Function: nucleic acid binding; transcription corepressor activity

Biological Process: regulation of transcription, DNA-templated; transcription, DNA-dependent
Show more

Research Articles on SSX4

1. loss of miR-4731 expression in stage IV patient tumors supports melanoma growth by, in part, reducing its regulatory control of SSX expression levels

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000