• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TOMM22 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6139571

MBS6139571 is an antibody targeting TOMM22. Also known as TOMM22 (Translocase of Outer Membrane 22kD Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065) APC. Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TOMM22, Monoclonal Antibody
Full Product Name
TOMM22 (Translocase of Outer Membrane 22kD Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065) APC
Product Gene Name
anti-TOMM22 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human TOMM22. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
15,522 Da
Immunogen
Full length recombinant corresponding to aa1-143 from human TOMM22 (AAH09363) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Conjugate
APC

Product Categories/Family for anti-TOMM22 antibody

Antibodies; Enzymes
Applications Tested/Suitable for anti-TOMM22 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-TOMM22 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TOMM22 antibody

Western Blot detection against Immunogen (41.73kD).
Mouse Anti-TOMM22 Monoclonal Antibody – Cat# MBS6139571

Immunohistochemistry (IHC) of anti-TOMM22 antibody

Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].
Mouse Anti-TOMM22 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6139571

Immunofluorescence (IF) of anti-TOMM22 antibody

Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-TOMM22 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6139571

Testing Data of anti-TOMM22 antibody

Detection limit for recombinant GST tagged TOMM22 is 0.1ng/ml as a capture antibody.
Mouse Anti-TOMM22 Monoclonal Antibody, Testing Data – Cat# MBS6139571

Western Blot (WB) of anti-TOMM22 antibody

Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-TOMM22 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139571

Western Blot (WB) of anti-TOMM22 antibody

TOMM22 monoclonal antibody. Western Blot analysis of TOMM22 expression in PC-12.
Mouse Anti-TOMM22 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139571

Western Blot (WB) of anti-TOMM22 antibody

Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody. Lane 1: TOMM22 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.
Mouse Anti-TOMM22 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139571

Other Notes

Small volumes of anti-TOMM22 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TOMM22. It may not necessarily be applicable to this product.

NCBI GI #
39644866
NCBI GeneID
56993
NCBI Accession #
BC009363
NCBI Related Accession #
AAH09363
UniProt Related Accession #
Q9NS69
NCBI Official Full Name
Homo sapiens translocase of outer mitochondrial membrane 22 homolog (yeast), mRNA
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 22
NCBI Official Symbol
TOMM22
NCBI Official Synonym Symbols
1C9-2; TOM22; MST065; MSTP065
NCBI Protein Information
mitochondrial import receptor subunit TOM22 homolog

NCBI Summary for TOMM22

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq, Jul 2008]

Research Articles on TOMM22

1. Tom22 is essential for metabolic conversion, as its knockdown by small interfering RNA (siRNA) completely ablated progesterone conversion in both steroidogenic mouse Leydig MA-10 and human adrenal NCI cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-TOMM22 antibody

 Products by Pathway  Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Mitochondrial Protein Import Pathway antibodies  Mitochondrial Protein Import Pathway Diagram

Diseases associated with anti-TOMM22 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1 publications with TOMM22 and Neoplasms
 Carcinoma Antibodies  >1 publications with TOMM22 and Carcinoma
 Cell Transformation, Neoplastic Antibodies  >1 publications with TOMM22 and Cell Transformation, Neoplastic
 Liver Diseases Antibodies  >1 publications with TOMM22 and Liver Diseases

Organs/Tissues associated with anti-TOMM22 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >5 publications with TOMM22 and Liver
 Embryonic Tissue Antibodies  >1 publications with TOMM22 and Embryonic Tissue
 Muscle Antibodies  >1 publications with TOMM22 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000