• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

UHRF2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6139763

MBS6139763 is an antibody targeting UHRF2. Also known as UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
UHRF2, Monoclonal Antibody
Full Product Name
UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger Protein, NIRF, Np95-like RING Finger Protein, Nuclear
Product Gene Name
anti-UHRF2 antibody
Product Synonym Names
EC=6.3.2.-; URF2; RP11-472F14.2
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human UHRF2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
89,985 Da
Chromosome Location
Chromosome: 9; NC_000009.11 (6413151..6507054). Location: 9p24.1
OMIM
615211
3D Structure
ModBase 3D Structure for Q96PU4
Immunogen
Partial recombinant corresponding to aa81-181 from human UHRF2 (NP_690856) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Conjugate
APC

Product Categories/Family for anti-UHRF2 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-UHRF2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-UHRF2 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-UHRF2 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-UHRF2 Monoclonal Antibody – Cat# MBS6139763

Western Blot (WB) of anti-UHRF2 antibody

Western Blot analysis of UHRF2 expression in transfected 293T cell line by UHRF2 monoclonal antibody. Lane 1: UHRF2 transfected lysate (56.1kD). Lane 2: Non-transfected lysate.
Mouse Anti-UHRF2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139763

Immunofluorescence (IF) of anti-UHRF2 antibody

Immunofluorescence of monoclonal antibody to UHRF2 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-UHRF2 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6139763

Western Blot (WB) of anti-UHRF2 antibody

Western blot analysis of UHRF2 over-expressed 293 cell line, cotransfected with UHRF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with UHRF2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-UHRF2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139763

Other Notes

Small volumes of anti-UHRF2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for UHRF2. It may not necessarily be applicable to this product.

NCBI GI #
23312364
NCBI GeneID
115426
NCBI Accession #
NP_690856
UniProt Primary Accession #
Q96PU4
UniProt Secondary Accession #
Q5VYR1; Q5VYR3; Q659C8; Q8TAG7
UniProt Related Accession #
Q69YI0; Q96PU4
GenBank Nucleotide #
NM_152896
NCBI Official Full Name
E3 ubiquitin-protein ligase UHRF2
NCBI Official Synonym Full Names
ubiquitin-like with PHD and ring finger domains 2
NCBI Official Symbol
UHRF2
NCBI Official Synonym Symbols
NIRF; URF2; RNF107; MGC33463; DKFZp434B0920; DKFZp686G0837; RP11-472F14.2
UniProt Protein Name
E3 ubiquitin-protein ligase UHRF2
UniProt Synonym Protein Names
Np95/ICBP90-like RING finger protein; Np95-like RING finger protein; Nuclear protein 97; Nuclear zinc finger protein Np97; RING finger protein 107; Ubiquitin-like PHD and RING finger domain-containing protein 2; Ubiquitin-like-containing PHD and RING finger domains protein 2
Protein Family
E3 ubiquitin-protein ligase
UniProt Gene Name
UHRF2
UniProt Synonym Gene Names
NIRF; RNF107; Np95-like RING finger protein
UniProt Entry Name
UHRF2_HUMAN
NCBI Protein Information
E3 ubiquitin-protein ligase UHRF2; OTTHUMP00000021047; nuclear protein 97; RING finger protein 107; Np95-like ring finger protein; nuclear zinc finger protein NP97; np95/ICBP90-like RING finger protein; ubiquitin-like, containing PHD and RING finger domai

UniProt Comments for UHRF2

UHRF2: E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. Appears to contribute to tumorigenesis. Associated with various cancers. DNA copy number loss is found in multiple kinds of malignancies originating from the brain, breast, stomach, kidney, hematopoietic tissue and lung. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ubiquitin conjugating system; EC 6.3.2.19; Ubiquitin ligase; Cell cycle regulation; Ligase

Chromosomal Location of Human Ortholog: 9p24.1

Cellular Component: nucleoplasm; nuclear heterochromatin; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; histone binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; cell proliferation; protein autoubiquitination; regulation of cell cycle; protein ubiquitination; cell differentiation; cell cycle
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-UHRF2 antibody

 Reference Product  PubMed Publications
 DNMT1 antibody  >4 publications with UHRF2 and DNMT1
 HDAC1 antibody  >3 publications with UHRF2 and HDAC1
 PCNP antibody  >2 publications with UHRF2 and PCNP
 CDK2 antibody  >2 publications with UHRF2 and CDK2
 DNMT3B antibody  >1 publications with UHRF2 and DNMT3B

Diseases associated with anti-UHRF2 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >3 publications with UHRF2 and Nervous System Diseases
 Breast Neoplasms Antibodies  >2 publications with UHRF2 and Breast Neoplasms
 Brain Diseases Antibodies  >2 publications with UHRF2 and Brain Diseases
 Cell Transformation, Neoplastic Antibodies  >2 publications with UHRF2 and Cell Transformation, Neoplastic
 Liver Diseases Antibodies  >1 publications with UHRF2 and Liver Diseases

Organs/Tissues associated with anti-UHRF2 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >2 publications with UHRF2 and Lung
 Embryonic Tissue Antibodies  >2 publications with UHRF2 and Embryonic Tissue
 Brain Antibodies  >2 publications with UHRF2 and Brain
 Heart Antibodies  >1 publications with UHRF2 and Heart
 Ovary Antibodies  >1 publications with UHRF2 and Ovary
 Muscle Antibodies  >1 publications with UHRF2 and Muscle
 Kidney Antibodies  >1 publications with UHRF2 and Kidney
 Vascular Antibodies  >1 publications with UHRF2 and Vascular
 Mouth Antibodies  >1 publications with UHRF2 and Mouth
 Thyroid Antibodies  >1 publications with UHRF2 and Thyroid
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000