• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ZFP36L1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6139918

Probable regulatory protein involved in regulating the response to growth factors. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ZFP36L1, Monoclonal Antibody
Full Product Name
ZFP36L1 (Zinc Finger Protein 36, C3H1 Type-like 1, Butyrate Response Factor 1, EGF-response Factor 1, ERF-1, Protein TIS11B, BERG36, BRF1, ERF1, RNF162B, TIS11B) APC
Product Gene Name
anti-ZFP36L1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ZFP36L1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
36kDa
OMIM
601064
3D Structure
ModBase 3D Structure for Q07352
Immunogen
Partial recombinant corresponding to aa1-108 from human ZFP36L1 (NP_004917) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
Conjugate
APC

Product Categories/Family for anti-ZFP36L1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-ZFP36L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-ZFP36L1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ZFP36L1 antibody

Western Blot detection against Immunogen (37.62kD).
Mouse Anti-ZFP36L1 Monoclonal Antibody – Cat# MBS6139918

Western Blot (WB) of anti-ZFP36L1 antibody

Western Blot analysis of ZFP36L1 expression in transfected 293T cell line by ZFP36L1 monoclonal antibody. Lane 1: ZFP36L1 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.
Mouse Anti-ZFP36L1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139918

Testing Data of anti-ZFP36L1 antibody

Detection limit for recombinant GST tagged ZFP36L1 is ~1ng/ml as a capture antibody.
Mouse Anti-ZFP36L1 Monoclonal Antibody, Testing Data – Cat# MBS6139918

Western Blot (WB) of anti-ZFP36L1 antibody

Western blot analysis of ZFP36L1 over-expressed 293 cell line, cotransfected with ZFP36L1 Validated Chimera RNAi Lane 2) or non-transfected control (Lane 1). Blot probed with ZFP36L1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-ZFP36L1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6139918

Other Notes

Small volumes of anti-ZFP36L1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ZFP36L1 purchase

MBS6139918 is an antibody targeting ZFP36L1. Also known as ZFP36L1 (Zinc Finger Protein 36, C3H1 Type-like 1, Butyrate Response Factor 1, EGF-response Factor 1, ERF-1, Protein TIS11B, BERG36, BRF1, ERF1, RNF162B, TIS11B) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ZFP36L1. It may not necessarily be applicable to this product.

NCBI GI #
15812180
NCBI GeneID
677
NCBI Accession #
NP_004917
UniProt Primary Accession #
Q07352
UniProt Related Accession #
Q07352
GenBank Nucleotide #
NM_004926
NCBI Official Full Name
mRNA decay activator protein ZFP36L1 isoform 1
NCBI Official Synonym Full Names
ZFP36 ring finger protein like 1
NCBI Official Symbol
ZFP36L1
NCBI Official Synonym Symbols
BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B
UniProt Protein Name
Zinc finger protein 36, C3H1 type-like 1
UniProt Synonym Protein Names
Butyrate response factor 1; EGF-response factor 1; ERF-1; Protein TIS11B
Protein Family
mRNA decay activator protein
UniProt Gene Name
ZFP36L1
UniProt Synonym Gene Names
BERG36; BRF1; ERF1; RNF162B; TIS11B; ERF-1
UniProt Entry Name
TISB_HUMAN
NCBI Protein Information
mRNA decay activator protein ZFP36L1

NCBI Summary for ZFP36L1

This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Show more

UniProt Comments for ZFP36L1

BRF1: a zinc finger protein that plays an important role in the assembly of the RNA polymerase III initiation factor TFIIIB. Regulates mRNA levels by targeting transcripts containing AREs (AU-rich elements) into the decay pathway. Phosphorylation by Akt apparently generates 14-3-3 binding sites and inhibits BRF1 from promoting mRNA activity.Contains 2 C3H1-type zinc fingers.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 14q22-q24

Cellular Component: nucleus; cytosol

Molecular Function: mRNA binding; protein binding; DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of translation; neural tube development; cell proliferation; regulation of transcription, DNA-dependent; apoptosis; heart development; multicellular organism growth; T cell differentiation in the thymus; gene expression; regulation of mRNA stability; vasculogenesis; mRNA catabolic process, deadenylation-dependent decay
Show more

Research Articles on ZFP36L1

1. A ZFP36L1-mediated regulatory circuit through repressing CDK6 expression.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ZFP36L1 antibody

 Reference Product  PubMed Publications
 MYC antibody  >2 publications with ZFP36L1 and MYC

Pathways associated with anti-ZFP36L1 antibody

 Products by Pathway  Pathway Diagram
 Butyrate Response Factor 1 (BRF1) Destabilizes MRNA Pathway antibodies  Butyrate Response Factor 1 (BRF1) Destabilizes MRNA Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Regulation Of MRNA Stability By Proteins That Bind AU-rich Elements Pathway antibodies  Regulation Of MRNA Stability By Proteins That Bind AU-rich Elements Pathway Diagram
 Validated Targets Of C-MYC Transcriptional Repression Pathway antibodies  Validated Targets Of C-MYC Transcriptional Repression Pathway Diagram

Diseases associated with anti-ZFP36L1 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >8 publications with ZFP36L1 and Carcinoma
 Inflammation Antibodies  >8 publications with ZFP36L1 and Inflammation
 Necrosis Antibodies  >7 publications with ZFP36L1 and Necrosis
 Neoplasms, Experimental Antibodies  >4 publications with ZFP36L1 and Neoplasms, Experimental
 Liver Diseases Antibodies  >4 publications with ZFP36L1 and Liver Diseases
 Adenocarcinoma Antibodies  >4 publications with ZFP36L1 and Adenocarcinoma
 Liver Neoplasms Antibodies  >3 publications with ZFP36L1 and Liver Neoplasms
 Carcinoma, Hepatocellular Antibodies  >3 publications with ZFP36L1 and Carcinoma, Hepatocellular
 Breast Neoplasms Antibodies  >2 publications with ZFP36L1 and Breast Neoplasms
 Neural Tube Defects Antibodies  >2 publications with ZFP36L1 and Neural Tube Defects

Organs/Tissues associated with anti-ZFP36L1 antibody

 Organ/Tissue Name  Pubmed Publications
 Vascular Antibodies  >7 publications with ZFP36L1 and Vascular
 Blood Antibodies  >6 publications with ZFP36L1 and Blood
 Liver Antibodies  >5 publications with ZFP36L1 and Liver
 Kidney Antibodies  >4 publications with ZFP36L1 and Kidney
 Placenta Antibodies  >4 publications with ZFP36L1 and Placenta
 Muscle Antibodies  >4 publications with ZFP36L1 and Muscle
 Bone Antibodies  >4 publications with ZFP36L1 and Bone
 Heart Antibodies  >3 publications with ZFP36L1 and Heart
 Embryonic Tissue Antibodies  >3 publications with ZFP36L1 and Embryonic Tissue
 Lung Antibodies  >2 publications with ZFP36L1 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000