• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CSPG5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6141385

CSPG5 may function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CSPG5, Monoclonal Antibody
Full Product Name
CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034) (Biotin)
Product Gene Name
anti-CSPG5 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CSPG5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
54kDa
OMIM
606775
3D Structure
ModBase 3D Structure for O95196
Immunogen
Partial recombinant corresponding to aa445-539 from human CSPG5 (NP_006565) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Conjugate
Biotin

Product Categories/Family for anti-CSPG5 antibody

Antibodies; Leucine-rich Proteins
Applications Tested/Suitable for anti-CSPG5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-CSPG5 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CSPG5 antibody

Western Blot detection against Immunogen (36.56kD).
Mouse Anti-CSPG5 Monoclonal Antibody – Cat# MBS6141385

Testing Data of anti-CSPG5 antibody

Detection limit for recombinant GST tagged CSPG5 is ~1ng/ml as a capture antibody.
Mouse Anti-CSPG5 Monoclonal Antibody, Testing Data – Cat# MBS6141385

Other Notes

Small volumes of anti-CSPG5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CSPG5 purchase

MBS6141385 is an antibody targeting CSPG5. Also known as CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034) (Biotin). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CSPG5. It may not necessarily be applicable to this product.

NCBI GI #
139394621
NCBI GeneID
10675
NCBI Accession #
NP_006565
UniProt Primary Accession #
O95196
UniProt Related Accession #
O95196
GenBank Nucleotide #
NM_006574
NCBI Official Full Name
chondroitin sulfate proteoglycan 5 isoform 1
NCBI Official Synonym Full Names
chondroitin sulfate proteoglycan 5
NCBI Official Symbol
CSPG5
NCBI Official Synonym Symbols
NGC
UniProt Protein Name
Chondroitin sulfate proteoglycan 5
UniProt Synonym Protein Names
Acidic leucine-rich EGF-like domain-containing brain protein; Neuroglycan C
Protein Family
Chondroitin sulfate proteoglycan
UniProt Gene Name
CSPG5
UniProt Synonym Gene Names
CALEB; NGC
UniProt Entry Name
CSPG5_HUMAN
NCBI Protein Information
chondroitin sulfate proteoglycan 5

NCBI Summary for CSPG5

The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

UniProt Comments for CSPG5

CSPG5: May function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: Golgi apparatus; lysosomal lumen; endoplasmic reticulum membrane; membrane; Golgi lumen; integral to plasma membrane; extracellular region; integral to membrane

Molecular Function: protein binding; growth factor activity

Biological Process: chondroitin sulfate metabolic process; regulation of synaptic transmission; nervous system development; chondroitin sulfate biosynthetic process; intracellular transport; glycosaminoglycan metabolic process; axon regeneration; regulation of growth; carbohydrate metabolic process; chondroitin sulfate catabolic process; pathogenesis; dermatan sulfate biosynthetic process
Show more

Research Articles on CSPG5

1. results suggest that NGC may be a novel candidate gene, and neuregulin signaling pathways may play an important role in schizophrenia

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000