Mouse Anti-DFNA5 Monoclonal Antibody – Cat# MBS6141523

Detection limit for recombinant GST tagged DFNA5 is 3ng/ml as a capture antibody.

DFNA5 Antibody – Mouse Monoclonal

Name: DFNA5 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6141523
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6141523

MBS6141523 is an antibody targeting DFNA5. Also known as DFNA5 (Non-syndromic Hearing Impairment Protein 5, Inversely Correlated With Estrogen Receptor Expression 1, ICERE-1, ICERE1) (Biotin). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

DFNA5, Monoclonal Antibody

Full Product Name

DFNA5 (Non-syndromic Hearing Impairment Protein 5, Inversely Correlated With Estrogen Receptor Expression 1, ICERE-1, ICERE1) (Biotin)

Product Gene Name

anti-DFNA5 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1E10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human DFNA5.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

36,043 Da

OMIM

600994

3D Structure

ModBase 3D Structure for O60443

Immunogen

Partial recombinant corresponding to aa111-200 from human DFNA5 (NP_004394) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN

Conjugate

Biotin

Product Categories/Family for anti-DFNA5 antibody

Antibodies; Disease Markers

Applications Tested/Suitable for anti-DFNA5 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-DFNA5 antibody

Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-DFNA5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for DFNA5. It may not necessarily be applicable to this product.

NCBI GI #

4758154

NCBI GeneID

1687

NCBI Accession #

NP_004394.1

UniProt Primary Accession #

O60443

UniProt Secondary Accession #

O14590; Q08AQ8; Q9UBV3; A4D156; B2RAX9; B3KT05

UniProt Related Accession #

O60443

GenBank Nucleotide #

NM_004403

NCBI Official Full Name

gasdermin-E isoform a

NCBI Official Synonym Full Names

gasdermin E

NCBI Official Symbol

GSDME

NCBI Official Synonym Symbols

DFNA5; ICERE-1

UniProt Protein Name

Non-syndromic hearing impairment protein 5

UniProt Synonym Protein Names

Inversely correlated with estrogen receptor expression 1

Protein Family

Non-syndromic hearing impairment protein

UniProt Gene Name

DFNA5

UniProt Synonym Gene Names

ICERE1

UniProt Entry Name

DFNA5_HUMAN

NCBI Protein Information

gasdermin-E

NCBI Summary for DFNA5

Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

UniProt Comments for DFNA5

DFNA5: Involved in apoptosis and cell survival. Plays a role in the TP53-regulated cellular response to DNA damage probably by cooperating with TP53. Defects in DFNA5 are the cause of deafness autosomal dominant type 5 (DFNA5). DFNA5 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Is a tumor suppressor gene with an important role in major types of tumors. Could be a valuable molecular marker in cancer. Belongs to the gasdermin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: cytoplasm

Biological Process: negative regulation of cell proliferation; sensory perception of sound; inner ear receptor cell differentiation; apoptosis

Disease: Deafness, Autosomal Dominant 5

Research Articles on DFNA5

1. DFNA5 methylation shows strong potential as a biomarker for detection of breast cancer. Slightly increased methylation in histologically normal breast tissue surrounding the tumor suggests that it may be a good early detection marker.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.