• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FBXW11 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6141876

MBS6141876 is an antibody targeting FBXW11. Also known as FBXW11 (BTRCP2, FBW1B, FBXW1B, KIAA0696, F-box/WD Repeat-containing Protein 11, F-box and WD Repeats Protein beta-TrCP2, F-box/WD Repeat-containing Protein 1B, Homologous to Slimb Protein) (Biotin).… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FBXW11, Monoclonal Antibody
Full Product Name
FBXW11 (BTRCP2, FBW1B, FBXW1B, KIAA0696, F-box/WD Repeat-containing Protein 11, F-box and WD Repeats Protein beta-TrCP2, F-box/WD Repeat-containing Protein 1B, Homologous to Slimb Protein) (Biotin)
Product Gene Name
anti-FBXW11 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human FBXW11.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
60,898 Da
Immunogen
Full length recombinant corresponding to aa1-530 from FBXW11 (AAH26213) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKT
Conjugate
Biotin

Product Categories/Family for anti-FBXW11 antibody

Antibodies; WD Repeat Proteins
Applications Tested/Suitable for anti-FBXW11 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes for anti-FBXW11 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Immunofluorescence (IF) of anti-FBXW11 antibody

Immunofluorescence of monoclonal antibody to FBXW11 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-FBXW11 Monoclonal Antibody – Cat# MBS6141876

Testing Data of anti-FBXW11 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between WEE1 and FBXW11. HeLa cells were stained with WEE1 rabbit purified polyclonal 1:1200 and FBXW11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-FBXW11 Monoclonal Antibody, Testing Data – Cat# MBS6141876

Other Notes

Small volumes of anti-FBXW11 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for FBXW11. It may not necessarily be applicable to this product.

NCBI GI #
20070727
NCBI GeneID
23291
NCBI Accession #
BC026213
NCBI Related Accession #
AAH26213
UniProt Secondary Accession #
Q9P2S8; Q9P2S9; Q9Y4C6; B2RC98
UniProt Related Accession #
Q9UKB1
NCBI Official Full Name
Homo sapiens F-box and WD repeat domain containing 11, mRNA
NCBI Official Synonym Full Names
F-box and WD repeat domain containing 11
NCBI Official Symbol
FBXW11
NCBI Official Synonym Symbols
Hos; BTRC2; FBW1B; Fbw11; BTRCP2; FBXW1B
Protein Family
F-box/WD repeat-containing protein
NCBI Protein Information
F-box/WD repeat-containing protein 11; F-box and WD repeats protein beta-TrCP2; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box protein Fbw1b; F-box/WD repeat-containing protein 1B; beta-transducin repeat-containing protein 2;

NCBI Summary for FBXW11

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. [provided by RefSeq, Jul 2008]
Show more

Research Articles on FBXW11

1. SCF(FBXW11) bound, polyubiquitylated, and destabilized RAPGEF2, a guanine nucleotide exchange factor that activates the small GTPase RAP1

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-FBXW11 antibody

 Reference Product  PubMed Publications
 CTNNB1 antibody  >11 publications with FBXW11 and CTNNB1
 BTRC antibody  >11 publications with FBXW11 and BTRC
 SKP1 antibody  >11 publications with FBXW11 and SKP1
 CUL1 antibody  >5 publications with FBXW11 and CUL1
 SKP2 antibody  >2 publications with FBXW11 and SKP2

Pathways associated with anti-FBXW11 antibody

 Products by Pathway  Pathway Diagram
 Activation Of NF-kappaB In B Cells Pathway antibodies  Activation Of NF-kappaB In B Cells Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies  Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
 Canonical Wnt Signaling Pathway antibodies  Canonical Wnt Signaling Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Circadian Rhythm Pathway antibodies  Circadian Rhythm Pathway Diagram
 Circadian Rhythm Pathway antibodies  Circadian Rhythm Pathway Diagram
 Class I MHC Mediated Antigen Processing & Presentation Pathway antibodies  Class I MHC Mediated Antigen Processing & Presentation Pathway Diagram
 Downstream Signaling Events Of B Cell Receptor (BCR) Pathway antibodies  Downstream Signaling Events Of B Cell Receptor (BCR) Pathway Diagram

Diseases associated with anti-FBXW11 antibody

 Disease Name  Pubmed Publications
 Necrosis Antibodies  >5 publications with FBXW11 and Necrosis
 Adenocarcinoma Antibodies  >1 publications with FBXW11 and Adenocarcinoma
 Kidney Diseases Antibodies  >1 publications with FBXW11 and Kidney Diseases
 Inflammation Antibodies  >1 publications with FBXW11 and Inflammation

Organs/Tissues associated with anti-FBXW11 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >3 publications with FBXW11 and Lung
 Heart Antibodies  >2 publications with FBXW11 and Heart
 Nerve Antibodies  >1 publications with FBXW11 and Nerve
 Bone Antibodies  >1 publications with FBXW11 and Bone
 Liver Antibodies  >1 publications with FBXW11 and Liver
 Stomach Antibodies  >1 publications with FBXW11 and Stomach
 Kidney Antibodies  >1 publications with FBXW11 and Kidney
 Intestine Antibodies  >1 publications with FBXW11 and Intestine
 Embryonic Tissue Antibodies  >1 publications with FBXW11 and Embryonic Tissue
 Brain Antibodies  >1 publications with FBXW11 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000