• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GRM5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6142172

Receptor for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GRM5, Monoclonal Antibody
Full Product Name
GRM5 (Metabotropic Glutamate Receptor 5, mGluR5, GPRC1E, MGLUR5) (Biotin)
Product Gene Name
anti-GRM5 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GRM5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
105,432 Da
OMIM
D28538 mRNA
3D Structure
ModBase 3D Structure for P41594
Immunogen
Partial recombinant corresponding to aa419-518 from human GRM5 (NP_000833) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKG
Conjugate
Biotin

Product Categories/Family for anti-GRM5 antibody

Antibodies; Receptors
Applications Tested/Suitable for anti-GRM5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GRM5 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GRM5 antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-GRM5 Monoclonal Antibody – Cat# MBS6142172

Testing Data of anti-GRM5 antibody

Detection limit for recombinant GST tagged GRM5 is ~0.03ng/ml as a capture antibody.
Mouse Anti-GRM5 Monoclonal Antibody, Testing Data – Cat# MBS6142172

Testing Data of anti-GRM5 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between PRKCD and GRM5. HeLa cells were stained with PRKCD rabbit purified polyclonal 1:1200 and GRM5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-GRM5 Monoclonal Antibody, Testing Data – Cat# MBS6142172

Other Notes

Small volumes of anti-GRM5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GRM5 purchase

MBS6142172 is an antibody targeting GRM5. Also known as GRM5 (Metabotropic Glutamate Receptor 5, mGluR5, GPRC1E, MGLUR5) (Biotin). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GRM5. It may not necessarily be applicable to this product.

NCBI GI #
4504143
NCBI GeneID
2915
NCBI Accession #
NP_000833
UniProt Primary Accession #
P41594
UniProt Secondary Accession #
Q6J164
UniProt Related Accession #
P41594
GenBank Nucleotide #
NM_000842
NCBI Official Full Name
metabotropic glutamate receptor 5 isoform b
NCBI Official Synonym Full Names
glutamate metabotropic receptor 5
NCBI Official Symbol
GRM5
NCBI Official Synonym Symbols
mGlu5; GPRC1E; MGLUR5; PPP1R86
UniProt Protein Name
Metabotropic glutamate receptor 5
Protein Family
Metabotropic glutamate receptor
UniProt Gene Name
GRM5
UniProt Synonym Gene Names
GPRC1E; MGLUR5; mGluR5
NCBI Protein Information
metabotropic glutamate receptor 5

NCBI Summary for GRM5

This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the regulation of neural network activity and synaptic plasticity. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. A pseudogene of this gene has been defined on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Show more

UniProt Comments for GRM5

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. Plays an important role in the regulation of synaptic plasticity and the modulation of the neural network activity.
Show more

Research Articles on GRM5

1. We report that expression of a key regulator of synaptic protein synthesis, the metabotropic glutamate receptor 5 (mGlu5) protein, is significantly reduced in both the brains of RS model mice and in the motor cortex of human RS autopsy samples.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GRM5 antibody

 Reference Product  PubMed Publications
 MAPK1 antibody  >16 publications with GRM5 and MAPK1
 FOS antibody  >16 publications with GRM5 and FOS
 HOMER1 antibody  >7 publications with GRM5 and HOMER1
 CDK5 antibody  >3 publications with GRM5 and CDK5
 SHANK3 antibody  >2 publications with GRM5 and SHANK3

Pathways associated with anti-GRM5 antibody

 Products by Pathway  Pathway Diagram
 Calcium Signaling Pathway antibodies  Calcium Signaling Pathway Diagram
 Calcium Signaling Pathway antibodies  Calcium Signaling Pathway Diagram
 Class C/3 (Metabotropic Glutamate/pheromone Receptors) Pathway antibodies  Class C/3 (Metabotropic Glutamate/pheromone Receptors) Pathway Diagram
 Common Pathways Underlying Drug Addiction antibodies  Common Pathways Underlying Drug Addiction Diagram
 G Alpha (q) Signalling Events Pathway antibodies  G Alpha (q) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 GPCRs, Class C Metabotropic Glutamate, Pheromone Pathway antibodies  GPCRs, Class C Metabotropic Glutamate, Pheromone Pathway Diagram
 Gap Junction Pathway antibodies  Gap Junction Pathway Diagram
 Gap Junction Pathway antibodies  Gap Junction Pathway Diagram

Diseases associated with anti-GRM5 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >329 publications with GRM5 and Nervous System Diseases
 Mental Disorders Antibodies  >194 publications with GRM5 and Mental Disorders
 Central Nervous System Diseases Antibodies  >178 publications with GRM5 and Central Nervous System Diseases
 Brain Diseases Antibodies  >166 publications with GRM5 and Brain Diseases
 Disease Models, Animal Antibodies  >149 publications with GRM5 and Disease Models, Animal
 Pain Antibodies  >124 publications with GRM5 and Pain
 Neurobehavioral Manifestations Antibodies  >75 publications with GRM5 and Neurobehavioral Manifestations
 Movement Disorders Antibodies  >73 publications with GRM5 and Movement Disorders
 Substance-Related Disorders Antibodies  >70 publications with GRM5 and Substance-Related Disorders
 Seizures Antibodies  >40 publications with GRM5 and Seizures

Organs/Tissues associated with anti-GRM5 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >809 publications with GRM5 and Brain
 Eye Antibodies  >14 publications with GRM5 and Eye
 Embryonic Tissue Antibodies  >13 publications with GRM5 and Embryonic Tissue
 Testis Antibodies  >3 publications with GRM5 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000