Mouse Anti-KCNK5 Monoclonal Antibody – Cat# MBS6142576

Detection limit for recombinant GST tagged KCNK5 is 1ng/ml as a capture antibody.

KCNK5 Antibody – Mouse Monoclonal

Name: KCNK5 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6142576
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6142576

pH-dependent, voltage insensitive, outwardly rectifying potassium channel. Outward rectification is lost at high external K(+) concentrations. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

KCNK5, Monoclonal Antibody

Full Product Name

KCNK5 (Potassium Channel Subfamily K Member 5, Acid-sensitive Potassium Channel Protein TASK-2, TWIK-related Acid-sensitive K(+) Channel 2, TASK2, FLJ11035, K2p5.1) (Biotin)

Product Gene Name

anti-KCNK5 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2B4

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human KCNK5.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

Full length recombinant corresponding to aa1-500 from KCNK5 (AAH60793) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKA

Conjugate

Biotin

Product Categories/Family for anti-KCNK5 antibody

Antibodies; Ion Channel

Applications Tested/Suitable for anti-KCNK5 antibody

ELISA (EIA)

Application Notes for anti-KCNK5 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-KCNK5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KCNK5 purchase

MBS6142576 is an antibody targeting KCNK5. Also known as KCNK5 (Potassium Channel Subfamily K Member 5, Acid-sensitive Potassium Channel Protein TASK-2, TWIK-related Acid-sensitive K(+) Channel 2, TASK2, FLJ11035, K2p5.1) (Biotin). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for KCNK5. It may not necessarily be applicable to this product.

NCBI GI #

38174511

NCBI GeneID

8645

NCBI Accession #

BC060793

NCBI Related Accession #

AAH60793

UniProt Related Accession #

O95279

NCBI Official Full Name

Homo sapiens potassium channel, subfamily K, member 5, mRNA

NCBI Official Synonym Full Names

potassium two pore domain channel subfamily K member 5

NCBI Official Symbol

KCNK5

NCBI Official Synonym Symbols

TASK2; K2p5.1; KCNK5b; TASK-2

Protein Family

Potassium channel subfamily

NCBI Protein Information

potassium channel subfamily K member 5

NCBI Summary for KCNK5

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport. [provided by RefSeq, Jul 2008]

Research Articles on KCNK5

1. mutations in the promoter region of the TWIK-related acid-sensitive K(+) channel 2 (TASK-2) gene did not result in hypertension or primary aldosteronism (PA) during long-term follow-up in healthy participants thus they do not seem to be a factor in causing PA by themselves.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.