• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NEIL2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6143140

MBS6143140 is an antibody targeting NEIL2. Also known as NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NEIL2, Monoclonal Antibody
Full Product Name
NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (Biotin)
Product Gene Name
anti-NEIL2 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NEIL2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant protein corresponding to aa1-333 from human NEIL2 (AAH13964) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Conjugate
Biotin

Product Categories/Family for anti-NEIL2 antibody

Antibodies; Endonucleases
Applications Tested/Suitable for anti-NEIL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-NEIL2 antibody
Sandwich ELISA: The detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody.
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NEIL2 antibody

Western Blot detection against Immunogen (62.63kD).
Mouse Anti-NEIL2 Monoclonal Antibody – Cat# MBS6143140

Western Blot (WB) of anti-NEIL2 antibody

Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 monoclonal antibody. Lane 1: NEIL2 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.
Mouse Anti-NEIL2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143140

Testing Data of anti-NEIL2 antibody

Detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody.
Mouse Anti-NEIL2 Monoclonal Antibody, Testing Data – Cat# MBS6143140

Western Blot (WB) of anti-NEIL2 antibody

Western blot analysis of NEIL2 over-expressed 293 cell line, cotransfected with NEIL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NEIL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-NEIL2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143140

Other Notes

Small volumes of anti-NEIL2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for NEIL2. It may not necessarily be applicable to this product.

NCBI GI #
38196943
NCBI GeneID
252969
NCBI Accession #
BC013964
NCBI Related Accession #
AAH13964
UniProt Related Accession #
Q969S2
NCBI Official Full Name
Homo sapiens nei like 2 (E. coli), mRNA
NCBI Official Synonym Full Names
nei like DNA glycosylase 2
NCBI Official Symbol
NEIL2
NCBI Official Synonym Symbols
NEH2; NEI2
Protein Family
Endonuclease
NCBI Protein Information
endonuclease 8-like 2

NCBI Summary for NEIL2

This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017]
Show more

Research Articles on NEIL2

1. Correlations between loss of expression of three genes: CETN2 (P < 0.001) and ERCC1 (P = 0.01) from the nucleotide excision repair (NER) and NEIL2 (P = 0.04) from the base excision repair (BER) pathways were associated with endocrine treatment resistance in discovery dataset, and subsequently validated in independent patient cohorts.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000