• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PPP1R2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6143703

MBS6143703 is an antibody targeting PPP1R2. Also known as PPP1R2 (Protein Phosphatase Inhibitor 2, IPP-2, IPP2, MGC87148) (Biotin). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PPP1R2, Monoclonal Antibody
Full Product Name
PPP1R2 (Protein Phosphatase Inhibitor 2, IPP-2, IPP2, MGC87148) (Biotin)
Product Gene Name
anti-PPP1R2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PPP1R2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
21kDa (189aa), confirmed by MALDI-TOF
OMIM
601792
3D Structure
ModBase 3D Structure for P41236
Immunogen
Partial recombinant corresponding to aa1-100 from human PPP1R2 (NP_006232) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
Conjugate
Biotin

Product Categories/Family for anti-PPP1R2 antibody

Antibodies; Enzymes; Phosphatase
Applications Tested/Suitable for anti-PPP1R2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-PPP1R2 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PPP1R2 antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-PPP1R2 Monoclonal Antibody – Cat# MBS6143703

Immunohistochemistry (IHC) of anti-PPP1R2 antibody

Immunoperoxidase of monoclonal antibody to PPP1R2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml]
Mouse Anti-PPP1R2 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6143703

Testing Data of anti-PPP1R2 antibody

Detection limit for recombinant GST tagged PPP1R2 is 0.1ng/ml as a capture antibody.
Mouse Anti-PPP1R2 Monoclonal Antibody, Testing Data – Cat# MBS6143703

Other Notes

Small volumes of anti-PPP1R2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PPP1R2. It may not necessarily be applicable to this product.

NCBI GI #
5453946
NCBI GeneID
5504
NCBI Accession #
NP_006232
UniProt Primary Accession #
P41236
UniProt Related Accession #
P41236
GenBank Nucleotide #
NM_006241
NCBI Official Full Name
protein phosphatase inhibitor 2 isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 2
NCBI Official Symbol
PPP1R2
NCBI Official Synonym Symbols
IPP2; IPP-2; PPP1R2A
UniProt Protein Name
Protein phosphatase inhibitor 2
Protein Family
Protein phosphatase inhibitor
UniProt Gene Name
PPP1R2
UniProt Synonym Gene Names
IPP2; IPP-2
UniProt Entry Name
IPP2_HUMAN
NCBI Protein Information
protein phosphatase inhibitor 2

NCBI Summary for PPP1R2

Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human genome. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Show more

UniProt Comments for PPP1R2

PPP1R2: a member of the protein phosphatase inhibitor 1 family. A dopamine- and cyclic AMP-regulated neuronal phosphoprotein. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions. Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32; phosphorylated DARPP32 is a potent protein phosphatase-1 inhibitor. NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32. Two alternatively-spliced isoforms have been described.

Protein type: Inhibitor; Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q29

Molecular Function: protein binding; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: glycogen metabolic process; generation of precursor metabolites and energy; negative regulation of catalytic activity; regulation of signal transduction; regulation of phosphoprotein phosphatase activity
Show more

Research Articles on PPP1R2

1. The results show that contrary to initial observations PPP1R2-related pseudogenes are not simple bystanders of the evolutionary process but may rather be at the origin of genes with novel functions.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PPP1R2 antibody

 Reference Product  PubMed Publications
 PPP1CC antibody  >1 publications with PPP1R2 and PPP1CC
 PPP1CA antibody  >1 publications with PPP1R2 and PPP1CA

Diseases associated with anti-PPP1R2 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1 publications with PPP1R2 and Neoplasms
 Kidney Diseases Antibodies  >1 publications with PPP1R2 and Kidney Diseases

Organs/Tissues associated with anti-PPP1R2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >2 publications with PPP1R2 and Brain
 Kidney Antibodies  >1 publications with PPP1R2 and Kidney
 Lung Antibodies  >1 publications with PPP1R2 and Lung
 Testis Antibodies  >1 publications with PPP1R2 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000