• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PRPS1L1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6143770

MBS6143770 is an antibody targeting PRPS1L1. Also known as PRPS1L1 (Phosphoribosyl Pyrophosphate Synthase 1-like 1, PRPS1-like 1, PRPSL, Ribose-phosphate Pyrophosphokinase 3, PRPS3, Phosphoribosyl Pyrophosphate Synthase III, PRS-III) (Biotin). Reactive in… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PRPS1L1, Monoclonal Antibody
Full Product Name
PRPS1L1 (Phosphoribosyl Pyrophosphate Synthase 1-like 1, PRPS1-like 1, PRPSL, Ribose-phosphate Pyrophosphokinase 3, PRPS3, Phosphoribosyl Pyrophosphate Synthase III, PRS-III) (Biotin)
Product Gene Name
anti-PRPS1L1 antibody
Product Synonym Names
EC=2.7.6.1
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
5E10
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PRPS1L1. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
34,839 Da
OMIM
611566
3D Structure
ModBase 3D Structure for P21108
Immunogen
Partial recombinant protein corresponding to aa146-244 from human PRPS1L1 (NP_787082) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR
Conjugate
Biotin

Product Categories/Family for anti-PRPS1L1 antibody

Antibodies; Enzymes; Synthase
Applications Tested/Suitable for anti-PRPS1L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PRPS1L1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PRPS1L1 antibody

Western Blot detection against Immunogen (36.89kD).
Mouse Anti-PRPS1L1 Monoclonal Antibody – Cat# MBS6143770

Western Blot (WB) of anti-PRPS1L1 antibody

PRPS1L1 monoclonal antibody, Western Blot analysis of PRPS1L1 expression in HeLa.
Mouse Anti-PRPS1L1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143770

Western Blot (WB) of anti-PRPS1L1 antibody

PRPS1L1 monoclonal antibody. Western Blot analysis of PRPS1L1 expression in PC-12.
Mouse Anti-PRPS1L1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143770

Western Blot (WB) of anti-PRPS1L1 antibody

PRPS1L1 monoclonal antibody. Western Blot analysis of PRPS1L1 expression in Raw 264.7.
Mouse Anti-PRPS1L1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143770

Western Blot (WB) of anti-PRPS1L1 antibody

PRPS1L1 monoclonal antibody (M01). Western Blot analysis of PRPS1L1 expression in NIH/3T3.
Mouse Anti-PRPS1L1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143770

Other Notes

Small volumes of anti-PRPS1L1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PRPS1L1. It may not necessarily be applicable to this product.

NCBI GI #
28557709
NCBI GeneID
221823
NCBI Accession #
NP_787082
UniProt Primary Accession #
P21108
UniProt Secondary Accession #
Q6P5P6
UniProt Related Accession #
P21108
GenBank Nucleotide #
NM_175886
NCBI Official Full Name
ribose-phosphate pyrophosphokinase 3
NCBI Official Synonym Full Names
phosphoribosyl pyrophosphate synthetase 1-like 1
NCBI Official Symbol
PRPS1L1
NCBI Official Synonym Symbols
PRPS1; PRPS3; PRPSL; PRS-III
UniProt Protein Name
Ribose-phosphate pyrophosphokinase 3
UniProt Synonym Protein Names
Phosphoribosyl pyrophosphate synthase 1-like 1; PRPS1-like 1; Phosphoribosyl pyrophosphate synthase III
Protein Family
Ribose-phosphate pyrophosphokinase
UniProt Gene Name
PRPS1L1
UniProt Synonym Gene Names
PRPS3; PRPSL
UniProt Entry Name
PRPS3_HUMAN
NCBI Protein Information
ribose-phosphate pyrophosphokinase 3

NCBI Summary for PRPS1L1

This intronless gene is specifically expressed in the testis, and encodes a protein that is highly homologous to the two subunits of phosphoribosylpyrophosphate synthetase encoded by human X-linked genes, PRPS1 and PRPS2. These enzymes convert pyrimidine, purine or pyridine bases to the corresponding ribonucleoside monophosphates. In vitro transcription/translation and site-directed mutagenesis studies indicate that translation of this mRNA initiates exclusively at a non-AUG (ACG) codon. [provided by RefSeq, Jul 2008]
Show more

Research Articles on PRPS1L1

1. Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PRPS1L1 antibody

 Products by Pathway  Pathway Diagram
 5-Phosphoribose 1-diphosphate Biosynthesis Pathway antibodies  5-Phosphoribose 1-diphosphate Biosynthesis Pathway Diagram
 Biosynthesis Of Amino Acids Pathway antibodies  Biosynthesis Of Amino Acids Pathway Diagram
 Biosynthesis Of Amino Acids Pathway antibodies  Biosynthesis Of Amino Acids Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Glycogen Storage Diseases Pathway antibodies  Glycogen Storage Diseases Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Carbohydrates Pathway antibodies  Metabolism Of Carbohydrates Pathway Diagram

Diseases associated with anti-PRPS1L1 antibody

 Disease Name  Pubmed Publications
 Learning Disorders Antibodies  >1 publications with PRPS1L1 and Learning Disorders
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000