• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RBM15 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6143958

MBS6143958 is an antibody targeting RBM15. Also known as RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (Biotin). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RBM15, Monoclonal Antibody
Full Product Name
RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (Biotin)
Product Gene Name
anti-RBM15 antibody
Product Synonym Names
FLJ12479; FLJ21943; MGC119584
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RBM15.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
606077
3D Structure
ModBase 3D Structure for Q96T37
Immunogen
Partial recombinant corresponding to aa701-811 from human RBM15 (NP_073605) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL
Conjugate
Biotin

Product Categories/Family for anti-RBM15 antibody

Antibodies; RNA Binding Proteins
Applications Tested/Suitable for anti-RBM15 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-RBM15 antibody
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RBM15 antibody

Western Blot detection against Immunogen (38.21kD).
Mouse Anti-RBM15 Monoclonal Antibody – Cat# MBS6143958

Testing Data of anti-RBM15 antibody

Detection limit for recombinant GST tagged RBM15 is 0.1ng/ml as a capture antibody.
Mouse Anti-RBM15 Monoclonal Antibody, Testing Data – Cat# MBS6143958

Other Notes

Small volumes of anti-RBM15 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RBM15. It may not necessarily be applicable to this product.

NCBI GI #
47933339
NCBI Accession #
NP_073605.4
UniProt Primary Accession #
Q96T37
GenBank Nucleotide #
NM_022768
NCBI Official Full Name
RNA-binding protein 15 isoform 1
UniProt Protein Name
Putative RNA-binding protein 15
UniProt Synonym Protein Names
One-twenty two protein 1; RNA-binding motif protein 15
Protein Family
Putative RNA-binding protein
UniProt Gene Name
RBM15
UniProt Synonym Gene Names
OTT; OTT1
UniProt Entry Name
RBM15_HUMAN

UniProt Comments for RBM15

RBM15: May be implicated in HOX gene regulation. A chromosomal aberration involving RBM15 may be a cause of acute megakaryoblastic leukemia. Translocation t(1;22)(p13;q13) with MKL1. Although both reciprocal fusion transcripts are detected in acute megakaryoblastic leukemia (AMKL, FAB-M7), the RBM15-MKL1 chimeric protein has all the putative functional domains encoded by each gene and is the candidate oncogene. Belongs to the RRM Spen family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; Oncoprotein; RNA-binding

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: nucleoplasm; nuclear membrane

Molecular Function: protein binding; nucleotide binding

Biological Process: spleen development; patterning of blood vessels; negative regulation of myeloid cell differentiation; viral reproduction; negative regulation of transcription, DNA-dependent; activation of Notch receptor target transcription factor
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RBM15 antibody

 Reference Product  PubMed Publications
 MKL1 antibody  >18 publications with RBM15 and MKL1
 NXF1 antibody  >4 publications with RBM15 and NXF1
 SETD1B antibody  >2 publications with RBM15 and SETD1B
 MKL2 antibody  >1 publications with RBM15 and MKL2

Diseases associated with anti-RBM15 antibody

 Disease Name  Pubmed Publications
 Breast Neoplasms Antibodies  >2 publications with RBM15 and Breast Neoplasms
 Genital Diseases, Male Antibodies  >1 publications with RBM15 and Genital Diseases, Male
 Fibrosis Antibodies  >1 publications with RBM15 and Fibrosis
 Anemia Antibodies  >1 publications with RBM15 and Anemia
 Hepatomegaly Antibodies  >1 publications with RBM15 and Hepatomegaly

Organs/Tissues associated with anti-RBM15 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >8 publications with RBM15 and Blood
 Muscle Antibodies  >1 publications with RBM15 and Muscle
 Placenta Antibodies  >1 publications with RBM15 and Placenta
 Brain Antibodies  >1 publications with RBM15 and Brain
 Embryonic Tissue Antibodies  >1 publications with RBM15 and Embryonic Tissue
 Liver Antibodies  >1 publications with RBM15 and Liver
 Testis Antibodies  >1 publications with RBM15 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000