• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RBM39 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6143960

MBS6143960 is an antibody targeting RBM39. Also known as RBM39 (HCC1, RNPC2, RNA-binding Protein 39, Hepatocellular Carcinoma Protein 1, RNA-binding Motif Protein 39, RNA-binding Region-containing Protein 2, Splicing Factor HCC1) (Biotin). Reactive in Human,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RBM39, Monoclonal Antibody
Full Product Name
RBM39 (HCC1, RNPC2, RNA-binding Protein 39, Hepatocellular Carcinoma Protein 1, RNA-binding Motif Protein 39, RNA-binding Region-containing Protein 2, Splicing Factor HCC1) (Biotin)
Product Gene Name
anti-RBM39 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G8
Host
Mouse
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RNPC2. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
604739
3D Structure
ModBase 3D Structure for Q14498
Immunogen
Partial recombinant corresponding to aa423-472 from RNPC2 (NP_909122) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Conjugate
Biotin

Product Categories/Family for anti-RBM39 antibody

Antibodies; Splicing Factors
Applications Tested/Suitable for anti-RBM39 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-RBM39 antibody
IF: 40ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RBM39 antibody

RNPC2 monoclonal antibody Western Blot analysis of RNPC2 expression in NIH/3T3
Mouse Anti-RBM39 Monoclonal Antibody – Cat# MBS6143960

Western Blot (WB) of anti-RBM39 antibody

Western Blot analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody. Lane 1: RBM39 transfected lysate (58.7kD). Lane 2: Non-transfected lysate.
Mouse Anti-RBM39 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6143960

Immunohistochemistry (IHC) of anti-RBM39 antibody

Immunoperoxidase of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml]
Mouse Anti-RBM39 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6143960

Immunofluorescence (IF) of anti-RBM39 antibody

Immunofluorescence of monoclonal antibody to RNPC2 on HeLa cell. [antibody concentration 40ug/ml]
Mouse Anti-RBM39 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6143960

Testing Data of anti-RBM39 antibody

Detection limit for recombinant GST tagged RNPC2 is ~0.03ng/ml as a capture antibody.
Mouse Anti-RBM39 Monoclonal Antibody, Testing Data – Cat# MBS6143960

Other Notes

Small volumes of anti-RBM39 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RBM39. It may not necessarily be applicable to this product.

NCBI GI #
35493811
NCBI GeneID
9584
NCBI Accession #
NP_909122
UniProt Primary Accession #
Q14498
UniProt Related Accession #
Q14498
GenBank Nucleotide #
NP_909122.1
NCBI Official Full Name
RNA-binding protein 39 isoform a
NCBI Official Synonym Full Names
RNA binding motif protein 39
NCBI Official Symbol
RBM39
NCBI Official Synonym Symbols
HCC1; CAPER; RNPC2; FSAP59; CAPERalpha
UniProt Protein Name
RNA-binding protein 39
UniProt Synonym Protein Names
CAPER alpha; Hepatocellular carcinoma protein 1; RNA-binding motif protein 39; RNA-binding region-containing protein 2; Splicing factor HCC1
Protein Family
RNA-binding protein
UniProt Gene Name
RBM39
UniProt Synonym Gene Names
HCC1; RNPC2
UniProt Entry Name
RBM39_HUMAN
NCBI Protein Information
RNA-binding protein 39

NCBI Summary for RBM39

This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X. [provided by RefSeq, Aug 2011]
Show more

UniProt Comments for RBM39

RNPC2: Transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. May be involved in pre-mRNA splicing process. Belongs to the splicing factor SR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; RNA-binding; Spliceosome

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: microtubule cytoskeleton; nucleoplasm; microtubule organizing center; nuclear speck

Molecular Function: protein binding; nucleotide binding

Biological Process: RNA processing; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA splicing; mRNA processing
Show more

Research Articles on RBM39

1. aryl-sulfonamides neo-functionalize a shallow, non-conserved pocket on DCAF15 to selectively bind and degrade RBM39 and the closely related splicing factor RBM23 without the requirement for a high-affinity ligand

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RBM39 antibody

 Reference Product  PubMed Publications
 U2AF2 antibody  >1 publications with RBM39 and U2AF2

Pathways associated with anti-RBM39 antibody

 Products by Pathway  Pathway Diagram
 MRNA Processing Pathway antibodies  MRNA Processing Pathway Diagram

Diseases associated with anti-RBM39 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >2 publications with RBM39 and Neoplasms
 Musculoskeletal Diseases Antibodies  >1 publications with RBM39 and Musculoskeletal Diseases
 Cell Transformation, Neoplastic Antibodies  >1 publications with RBM39 and Cell Transformation, Neoplastic

Organs/Tissues associated with anti-RBM39 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >2 publications with RBM39 and Muscle
 Embryonic Tissue Antibodies  >1 publications with RBM39 and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000