• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SCN3A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6144237

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SCN3A, Monoclonal Antibody
Full Product Name
SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)
Product Gene Name
anti-SCN3A antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SCN3A.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
182391
3D Structure
ModBase 3D Structure for Q9NY46
Immunogen
Partial recombinant corresponding to aa1861-1961 from human SCN3A (NP_008853) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG*
Conjugate
Biotin

Product Categories/Family for anti-SCN3A antibody

Antibodies; Ion Channel
Applications Tested/Suitable for anti-SCN3A antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-SCN3A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SCN3A antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-SCN3A Monoclonal Antibody – Cat# MBS6144237

Testing Data of anti-SCN3A antibody

Detection limit for recombinant GST tagged SCN3A is ~0.3ng/ml as a capture antibody.
Mouse Anti-SCN3A Monoclonal Antibody, Testing Data – Cat# MBS6144237

Other Notes

Small volumes of anti-SCN3A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SCN3A purchase

MBS6144237 is an antibody targeting SCN3A. Also known as SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SCN3A. It may not necessarily be applicable to this product.

NCBI GI #
126362949
NCBI GeneID
6328
NCBI Accession #
NP_008853
UniProt Primary Accession #
Q9NY46
UniProt Related Accession #
Q9NY46
GenBank Nucleotide #
NM_006922
NCBI Official Full Name
sodium channel protein type 3 subunit alpha isoform 1
NCBI Official Synonym Full Names
sodium voltage-gated channel alpha subunit 3
NCBI Official Symbol
SCN3A
NCBI Official Synonym Symbols
NAC3; EIEE62; FFEVF4; Nav1.3
UniProt Protein Name
Sodium channel protein type 3 subunit alpha
UniProt Synonym Protein Names
Sodium channel protein brain III subunit alpha; Sodium channel protein type III subunit alpha; Voltage-gated sodium channel subtype III; Voltage-gated sodium channel subunit alpha Nav1.3
Protein Family
Sodium channel protein
UniProt Gene Name
SCN3A
UniProt Synonym Gene Names
KIAA1356; NAC3
UniProt Entry Name
SCN3A_HUMAN
NCBI Protein Information
sodium channel protein type 3 subunit alpha

NCBI Summary for SCN3A

Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family, and is found in a cluster of five alpha subunit genes on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for SCN3A

SCN3A: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.3/SCN3A subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, sodium; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: voltage-gated sodium channel complex; cytoplasm; plasma membrane

Molecular Function: voltage-gated sodium channel activity

Biological Process: sodium ion transport; generation of action potential
Show more

Research Articles on SCN3A

1. SCN3A expression is involved in the prenatal development of human cortical language areas.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-SCN3A antibody

 Products by Pathway  Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Interaction Between L1 And Ankyrins Pathway antibodies  Interaction Between L1 And Ankyrins Pathway Diagram
 L1CAM Interactions Pathway antibodies  L1CAM Interactions Pathway Diagram

Diseases associated with anti-SCN3A antibody

 Disease Name  Pubmed Publications
 Congenital Abnormalities Antibodies  >4 publications with SCN3A and Congenital Abnormalities
 Abnormalities, Multiple Antibodies  >3 publications with SCN3A and Abnormalities, Multiple
 Cardiovascular Diseases Antibodies  >3 publications with SCN3A and Cardiovascular Diseases
 Nerve Degeneration Antibodies  >2 publications with SCN3A and Nerve Degeneration
 Heart Diseases Antibodies  >2 publications with SCN3A and Heart Diseases
 Necrosis Antibodies  >2 publications with SCN3A and Necrosis
 Heart Failure Antibodies  >2 publications with SCN3A and Heart Failure
 Epilepsy, Complex Partial Antibodies  >2 publications with SCN3A and Epilepsy, Complex Partial
 Developmental Disabilities Antibodies  >1 publications with SCN3A and Developmental Disabilities
 Inflammation Antibodies  >1 publications with SCN3A and Inflammation

Organs/Tissues associated with anti-SCN3A antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >65 publications with SCN3A and Nerve
 Brain Antibodies  >35 publications with SCN3A and Brain
 Muscle Antibodies  >12 publications with SCN3A and Muscle
 Embryonic Tissue Antibodies  >4 publications with SCN3A and Embryonic Tissue
 Mouth Antibodies  >2 publications with SCN3A and Mouth
 Kidney Antibodies  >2 publications with SCN3A and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000