Mouse Anti-SDHD Monoclonal Antibody – Cat# MBS6144253

Western Blot detection against Immunogen (37.55kD).

SDHD Antibody – Mouse Monoclonal

Name: SDHD Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6144253
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6144253

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SDHD, Monoclonal Antibody

Full Product Name

SDHD (SDH4, Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit, Mitochondrial, CII-4, QPs3, Succinate Dehydrogenase Complex Subunit D, Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit, Succinate-ubiquinone Reductase Membrane Anc

Product Gene Name

anti-SDHD antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

3F4

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SDHD.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa57-161 from human SDHD (AAH09574) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL**

Conjugate

Biotin

Product Categories/Family for anti-SDHD antibody

Antibodies; Enzymes; Dehydrogenase

Applications Tested/Suitable for anti-SDHD antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-SDHD antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SDHD antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SDHD purchase

MBS6144253 is an antibody targeting SDHD. Also known as SDHD (SDH4, Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit, Mitochondrial, CII-4, QPs3, Succinate Dehydrogenase Complex Subunit D, Succinate-ubiquinone Oxidoreductase Cytochrome b Small Subunit, Succinate-ubiquinone Reductase Membrane Anc. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SDHD. It may not necessarily be applicable to this product.

NCBI GI #

16306997

NCBI GeneID

6392

NCBI Accession #

BC009574

NCBI Related Accession #

AAH09574

UniProt Related Accession #

O14521

NCBI Official Full Name

Homo sapiens succinate dehydrogenase complex, subunit D, integral membrane protein, mRNA

NCBI Official Synonym Full Names

succinate dehydrogenase complex subunit D

NCBI Official Symbol

SDHD

NCBI Official Synonym Symbols

PGL; CBT1; CWS3; PGL1; QPs3; SDH4; cybS; CII-4

Protein Family

Succinate dehydrogenase

NCBI Protein Information

succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial

NCBI Summary for SDHD

This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]

Research Articles on SDHD

1. Carriers of succinate dehydrogenase (SDHx) mutations are at risk of developing phaeochromocytomas, catecholamine secreting extra-adrenal paragangliomas and non-secretory head and neck paragangliomas and require lifelong surveillance.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.