• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Atlastin-1 (ATL1) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6144556

MBS6144556 is an antibody targeting ATL1. Also known as Atlastin-1 (ATL1, Brain-specific GTP-binding Protein, GTP-binding Protein 3, GBP3, GBP-3, hGBP3, Guanine Nucleotide-binding Protein 3, Spastic Paraplegia 3 Protein A, SPG3A) (Biotin). Reactive in Human,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Atlastin-1 (ATL1), Monoclonal Antibody
Full Product Name
Atlastin-1 (ATL1, Brain-specific GTP-binding Protein, GTP-binding Protein 3, GBP3, GBP-3, hGBP3, Guanine Nucleotide-binding Protein 3, Spastic Paraplegia 3 Protein A, SPG3A) (Biotin)
Product Gene Name
anti-ATL1 antibody
Product Synonym Names
EC=3.6.5.-; AD-FSP; FSP1; HSN1D; SPG3
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Host
Mouse
Species Reactivity
Human, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SPG3A. Species Crossreactivity: rat.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
AY032844 mRNA
3D Structure
ModBase 3D Structure for Q8WXF7
Immunogen
Partial recombinant corresponding to aa1-101 from human SPG3A (NP_056999) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Conjugate
Biotin

Product Categories/Family for anti-ATL1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins
Applications Tested/Suitable for anti-ATL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-ATL1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ATL1 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-ATL1 Monoclonal Antibody – Cat# MBS6144556

Western Blot (WB) of anti-ATL1 antibody

SPG3A monoclonal antibody. Western Blot analysis of SPG3A expression in PC-12.
Mouse Anti-ATL1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6144556

Western Blot (WB) of anti-ATL1 antibody

SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in IMR-32.
Mouse Anti-ATL1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6144556

Testing Data of anti-ATL1 antibody

Detection limit for recombinant GST tagged SPG3A is ~1ng/ml as a capture antibody.
Mouse Anti-ATL1 Monoclonal Antibody, Testing Data – Cat# MBS6144556

Other Notes

Small volumes of anti-ATL1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ATL1. It may not necessarily be applicable to this product.

NCBI GI #
19923445
NCBI Accession #
NP_056999
UniProt Primary Accession #
Q8WXF7
GenBank Nucleotide #
NM_015915
NCBI Official Full Name
atlastin-1 isoform a
UniProt Protein Name
Atlastin-1
UniProt Synonym Protein Names
Brain-specific GTP-binding protein; GTP-binding protein 3; GBP-3; hGBP3; Guanine nucleotide-binding protein 3; Spastic paraplegia 3 protein A
Protein Family
Alkyltransferase-like protein
UniProt Gene Name
ATL1
UniProt Synonym Gene Names
GBP3; SPG3A; GBP-3; hGBP3

UniProt Comments for ATL1

atlastin: GTPase tethering membranes through formation of trans- homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis. May also regulate Golgi biogenesis. May regulate axonal development. Defects in ATL1 are the cause of spastic paraplegia autosomal dominant type 3 (SPG3); also known as Strumpell-Lorrain syndrome. Spastic paraplegia is a degenerative spinal cord disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Defects in ATL1 are the cause of hereditary sensory neuropathy type 1D (HSN1D). HSN1D is a disease characterized by adult-onset distal axonal sensory neuropathy leading to mutilating ulcerations as well as hyporeflexia. Some patients may show features suggesting upper neuron involvement. Belongs to the GBP family. Atlastin subfamily.

Protein type: EC 3.6.5.-; Membrane protein, integral; Membrane protein, multi-pass; Vesicle

Chromosomal Location of Human Ortholog: 14q22.1

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; Golgi apparatus; Golgi cis cisterna; integral to membrane

Molecular Function: GTP binding; GTPase activity; identical protein binding; protein binding

Biological Process: axonogenesis; endoplasmic reticulum organization and biogenesis; protein homooligomerization

Disease: Neuropathy, Hereditary Sensory, Type Id; Spastic Paraplegia 3, Autosomal Dominant
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ATL1 antibody

 Reference Product  PubMed Publications
 SPAST antibody  >29 publications with ATL1 and SPAST
 REEP1 antibody  >6 publications with ATL1 and REEP1
 NIPA1 antibody  >5 publications with ATL1 and NIPA1
 ZFYVE27 antibody  >1 publications with ATL1 and ZFYVE27
 KIAA0196 antibody  >1 publications with ATL1 and KIAA0196

Diseases associated with anti-ATL1 antibody

 Disease Name  Pubmed Publications
 Congenital Abnormalities Antibodies  >67 publications with ATL1 and Congenital Abnormalities
 Neurobehavioral Manifestations Antibodies  >8 publications with ATL1 and Neurobehavioral Manifestations
 Brain Diseases Antibodies  >7 publications with ATL1 and Brain Diseases
 Autoimmune Diseases Antibodies  >5 publications with ATL1 and Autoimmune Diseases
 Atrophy Antibodies  >4 publications with ATL1 and Atrophy
 Nerve Degeneration Antibodies  >3 publications with ATL1 and Nerve Degeneration
 Drug Toxicity Antibodies  >2 publications with ATL1 and Drug Toxicity
 Mental Disorders Antibodies  >2 publications with ATL1 and Mental Disorders
 Kidney Diseases Antibodies  >1 publications with ATL1 and Kidney Diseases
 Neoplasms Antibodies  >1 publications with ATL1 and Neoplasms

Organs/Tissues associated with anti-ATL1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >18 publications with ATL1 and Brain
 Nerve Antibodies  >12 publications with ATL1 and Nerve
 Muscle Antibodies  >9 publications with ATL1 and Muscle
 Bone Antibodies  >3 publications with ATL1 and Bone
 Kidney Antibodies  >3 publications with ATL1 and Kidney
 Skin Antibodies  >2 publications with ATL1 and Skin
 Connective Tissue Antibodies  >1 publications with ATL1 and Connective Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000