• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SRF Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6144581

Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF binding sites are also constitutive promotor elements in many… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SRF, Monoclonal Antibody
Full Product Name
SRF (Serum Response Factor) (Biotin)
Product Gene Name
anti-SRF antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SRF.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa406-508 of human SRF with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE
Conjugate
Biotin

Product Categories/Family for anti-SRF antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-SRF antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-SRF antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SRF antibody

Western Blot detection against Immunogen (37.44kD) using.
Mouse Anti-SRF Monoclonal Antibody – Cat# MBS6144581

Testing Data of anti-SRF antibody

Detection limit for recombinant GST tagged SRF is ~0.03ng/ml using as a capture antibody.
Mouse Anti-SRF Monoclonal Antibody, Testing Data – Cat# MBS6144581

Immunofluorescence (IF) of anti-SRF antibody

Immunofluorescence of HeLa cells using (10ug/ml).
Mouse Anti-SRF Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6144581

Other Notes

Small volumes of anti-SRF antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SRF purchase

MBS6144581 is an antibody targeting SRF. Also known as SRF (Serum Response Factor) (Biotin). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SRF. It may not necessarily be applicable to this product.

NCBI GI #
29386996
NCBI GeneID
6722
NCBI Accession #
BC048211
NCBI Related Accession #
AAH48211
UniProt Related Accession #
P11831
NCBI Official Full Name
Homo sapiens serum response factor (c-fos serum response element-binding transcription factor), mRNA
NCBI Official Synonym Full Names
serum response factor
NCBI Official Symbol
SRF
NCBI Official Synonym Symbols
MCM1
Protein Family
Serum response factor
NCBI Protein Information
serum response factor

NCBI Summary for SRF

This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Show more

Research Articles on SRF

1. Our findings indicate that overexpression of SRF may play an important role in human gastric cancer recurrence and prognosis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000