Mouse Anti-TM9SF2 Monoclonal Antibody – Cat# MBS6144833

Detection limit for recombinant GST tagged TM9SF2 is 0.03ng/ml as a capture antibody.

TM9SF2 Antibody – Mouse Monoclonal

Name: TM9SF2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6144833
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6144833

MBS6144833 is an antibody targeting TM9SF2. Also known as TM9SF2 (Transmembrane 9 Superfamily Member 2, p76) (Biotin). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TM9SF2, Monoclonal Antibody

Full Product Name

TM9SF2 (Transmembrane 9 Superfamily Member 2, p76) (Biotin)

Product Gene Name

anti-TM9SF2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1C2

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TM9SF2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

604678

3D Structure

ModBase 3D Structure for Q99805

Immunogen

Partial recombinant corresponding to aa116-215 from TM9SF2 (NP_004791) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVDIK

Conjugate

Biotin

Product Categories/Family for anti-TM9SF2 antibody

Antibodies; Membrane Proteins

Applications Tested/Suitable for anti-TM9SF2 antibody

ELISA (EIA)

Application Notes for anti-TM9SF2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-TM9SF2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TM9SF2. It may not necessarily be applicable to this product.

NCBI GI #

1653960525

NCBI GeneID

9375

NCBI Accession #

NM_004800.3

UniProt Primary Accession #

Q99805

UniProt Related Accession #

Q99805

GenBank Nucleotide #

NM_004800

NCBI Official Full Name

Homo sapiens transmembrane 9 superfamily member 2 (TM9SF2), mRNA

NCBI Official Synonym Full Names

transmembrane 9 superfamily member 2

NCBI Official Symbol

TM9SF2

NCBI Official Synonym Symbols

P76

UniProt Protein Name

Transmembrane 9 superfamily member 2

UniProt Synonym Protein Names

p76

UniProt Gene Name

TM9SF2

UniProt Entry Name

TM9S2_HUMAN

NCBI Protein Information

transmembrane 9 superfamily member 2

NCBI Summary for TM9SF2

This gene encodes a member of the transmembrane 9 superfamily. The encoded 76 kDa protein localizes to early endosomes in human cells. The encoded protein possesses a conserved and highly hydrophobic C-terminal domain which contains nine transmembrane domains. The protein may play a role in small molecule transport or act as an ion channel. A pseudogene associated with this gene is located on the X chromosome. [provided by RefSeq, Oct 2012]

UniProt Comments for TM9SF2

TM9SF2: In the intracellular compartments, may function as a channel or small molecule transporter. Belongs to the nonaspanin (TM9SF) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q32.3

Cellular Component: endosome; endosome membrane; integral to plasma membrane

Biological Process: transport

Research Articles on TM9SF2

1. TM9SF2 is identified as novel oncogene in colorectal cancer (CRC). TM9SF2 is potentially regulated by the Ets-family transcription factor ELF1, and TM9SF2 is upregulated in approximately one-third of human CRC samples. Transcriptome analysis of TM9SF2 knockout cells revealed a potential role for TM9SF2 in cell cycle progression, oxidative phosphorylation, and ceramide signaling.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.