• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

UPF3A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6145081

MBS6145081 is an antibody targeting UPF3A. Also known as UPF3A (Up-frameshift Suppressor 3 Homolog A, hUpf3, UPF3, Nonsense mRNA Reducing Factor 3A, Regulator of Nonsense Transcripts 3A, RENT3A) (Biotin). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
UPF3A, Monoclonal Antibody
Full Product Name
UPF3A (Up-frameshift Suppressor 3 Homolog A, hUpf3, UPF3, Nonsense mRNA Reducing Factor 3A, Regulator of Nonsense Transcripts 3A, RENT3A) (Biotin)
Product Gene Name
anti-UPF3A antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human UPF3A.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa274-375 from human UPF3A (AAH23569) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAP
Conjugate
Biotin

Product Categories/Family for anti-UPF3A antibody

Antibodies; DNA Replication; Repair
Applications Tested/Suitable for anti-UPF3A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-UPF3A antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-UPF3A antibody

Western Blot detection against Immunogen (37.22kD).
Mouse Anti-UPF3A Monoclonal Antibody – Cat# MBS6145081

Western Blot (WB) of anti-UPF3A antibody

Western Blot analysis of UPF3A expression in transfected 293T cell line by UPF3A monoclonal antibody. Lane 1: UPF3A transfected lysate (51kD). Lane 2: Non-transfected lysate.
Mouse Anti-UPF3A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6145081

Immunohistochemistry (IHC) of anti-UPF3A antibody

Immunoperoxidase of monoclonal antibody to UPF3A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].
Mouse Anti-UPF3A Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6145081

Testing Data of anti-UPF3A antibody

Detection limit for recombinant GST tagged UPF3A is 0.03ng/ml as a capture antibody.
Mouse Anti-UPF3A Monoclonal Antibody, Testing Data – Cat# MBS6145081

Other Notes

Small volumes of anti-UPF3A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for UPF3A. It may not necessarily be applicable to this product.

NCBI GI #
27881817
NCBI GeneID
65110
NCBI Accession #
BC023569
NCBI Related Accession #
AAH23569.1
UniProt Related Accession #
Q9H1J1
NCBI Official Full Name
Homo sapiens UPF3 regulator of nonsense transcripts homolog A (yeast), mRNA
NCBI Official Synonym Full Names
UPF3A regulator of nonsense mediated mRNA decay
NCBI Official Symbol
UPF3A
NCBI Official Synonym Symbols
UPF3; HUPF3A; RENT3A
Protein Family
Regulator of nonsense transcripts
NCBI Protein Information
regulator of nonsense transcripts 3A

NCBI Summary for UPF3A

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017]
Show more

Research Articles on UPF3A

1. Study observed that CHERP and its binding partner SR140 are significantly upregulated in human clinical colorectal cancer tissues (CRC) and clarified how CHERP/SR140 exert an oncogenic role in CRC development partially through regulating expression of UPF3A variants.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000