Mouse Anti-POLR1C Monoclonal Antibody – Cat# MBS6145529

POLR1C Antibody – Mouse Monoclonal

Name: POLR1C Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6145529
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6145529

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

POLR1C, Monoclonal Antibody

Full Product Name

POLR1C (Polymerase (RNA) I Polypeptide C, 30kD, OTTHUMP00000016470, RNA Polymerase I Subunit, RPA39, RPA40, RPA5, RPAC1) (Biotin)

Product Gene Name

anti-POLR1C antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2A5-A5

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified

Specificity

Recognizes human POLR1C.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

Recombinant protein corresponding to aa1-346 from full-length human POLR1C with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD

Conjugate

Biotin

Product Categories/Family for anti-POLR1C antibody

Antibodies; Enzymes; Polymerase

Applications Tested/Suitable for anti-POLR1C antibody

ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-POLR1C antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-POLR1C antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for POLR1C purchase

MBS6145529 is an antibody targeting POLR1C. Also known as POLR1C (Polymerase (RNA) I Polypeptide C, 30kD, OTTHUMP00000016470, RNA Polymerase I Subunit, RPA39, RPA40, RPA5, RPAC1) (Biotin). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for POLR1C. It may not necessarily be applicable to this product.

NCBI GI #

14250788

NCBI GeneID

9533

NCBI Accession #

AAH08863

UniProt Related Accession #

O15160

NCBI Official Full Name

Polymerase (RNA) I polypeptide C, 30kDa

NCBI Official Synonym Full Names

RNA polymerase I and III subunit C

NCBI Official Symbol

POLR1C

NCBI Official Synonym Symbols

AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40

Protein Family

DNA-directed RNA polymerases

NCBI Protein Information

DNA-directed RNA polymerases I and III subunit RPAC1

NCBI Summary for POLR1C

The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Research Articles on POLR1C

1. Treacher Collins syndrome 3-associated mutation leads to the localization of POLR1C into the lysosome and inhibits chondrogenic differentiation, possibly explaining a portion of the pathological molecular basis underlying Treacher Collins syndrome.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.