• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BID Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146128

The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BID, Monoclonal Antibody
Full Product Name
BID (BH3-interacting Domain Death Agonist, p22 BID) (FITC)
Product Gene Name
anti-BID antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F3-1A3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human BID.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
11,263 Da
Immunogen
Full length recombinant corresponding to aa1-195 from human BID (AAH09197) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Conjugate
FITC

Product Categories/Family for anti-BID antibody

Antibodies; Apoptosis
Applications Tested/Suitable for anti-BID antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-BID antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-BID antibody

Western Blot detection against Immunogen (47.19kD).
Mouse Anti-BID Monoclonal Antibody – Cat# MBS6146128

Western Blot (WB) of anti-BID antibody

Western Blot analysis of BID expression in transfected 293T cell line by BID monoclonal antibody. Lane 1: BID transfected lysate (22kD). Lane 2: Non-transfected lysate.
Mouse Anti-BID Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146128

Testing Data of anti-BID antibody

Detection limit for recombinant GST tagged BID is ~0.03ng/ml as a capture antibody.
Mouse Anti-BID Monoclonal Antibody, Testing Data – Cat# MBS6146128

Testing Data of anti-BID antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between FADD and BID. HeLa cells were stained with FADD rabbit purified polyclonal 1:1200 and BID mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-BID Monoclonal Antibody, Testing Data – Cat# MBS6146128

Other Notes

Small volumes of anti-BID antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for BID purchase

MBS6146128 is an antibody targeting BID. Also known as BID (BH3-interacting Domain Death Agonist, p22 BID) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for BID. It may not necessarily be applicable to this product.

NCBI GI #
33874361
NCBI GeneID
637
NCBI Accession #
BC009197
NCBI Related Accession #
AAH09197
UniProt Secondary Accession #
Q549M7; Q71T04; Q7Z4M9; Q8IY86
UniProt Related Accession #
P55957
NCBI Official Full Name
Homo sapiens BH3 interacting domain death agonist, mRNA
NCBI Official Synonym Full Names
BH3 interacting domain death agonist
NCBI Official Symbol
BID
NCBI Official Synonym Symbols
FP497
Protein Family
BH3-interacting domain death agonist
NCBI Protein Information
BH3-interacting domain death agonist

NCBI Summary for BID

This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]
Show more

Research Articles on BID

1. The BID-MTCH2 axis regulates the differentiation/apoptosis of stem cells and mitochondrial metabolism. (Review)

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-BID antibody

 Products by Pathway  Pathway Diagram
 Activation And Oligomerization Of BAK Protein Pathway antibodies  Activation And Oligomerization Of BAK Protein Pathway Diagram
 Activation Of BAD And Translocation To Mitochondria Pathway antibodies  Activation Of BAD And Translocation To Mitochondria Pathway Diagram
 Activation Of BH3-only Proteins Pathway antibodies  Activation Of BH3-only Proteins Pathway Diagram
 Activation, Myristolyation Of BID And Translocation To Mitochondria Pathway antibodies  Activation, Myristolyation Of BID And Translocation To Mitochondria Pathway Diagram
 Activation, Translocation And Oligomerization Of BAX Pathway antibodies  Activation, Translocation And Oligomerization Of BAX Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimers Disease Pathway antibodies  Alzheimers Disease Pathway Diagram
 Amyotrophic Lateral Sclerosis (ALS) Pathway antibodies  Amyotrophic Lateral Sclerosis (ALS) Pathway Diagram
 Amyotrophic Lateral Sclerosis (ALS) Pathway antibodies  Amyotrophic Lateral Sclerosis (ALS) Pathway Diagram

Diseases associated with anti-BID antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1639 publications with BID and Neoplasms
 Cardiovascular Diseases Antibodies  >797 publications with BID and Cardiovascular Diseases
 Necrosis Antibodies  >648 publications with BID and Necrosis
 Lung Diseases Antibodies  >618 publications with BID and Lung Diseases
 Drug Toxicity Antibodies  >613 publications with BID and Drug Toxicity
 Gastrointestinal Diseases Antibodies  >594 publications with BID and Gastrointestinal Diseases
 Nervous System Diseases Antibodies  >547 publications with BID and Nervous System Diseases
 Pain Antibodies  >415 publications with BID and Pain
 Heart Diseases Antibodies  >393 publications with BID and Heart Diseases
 Adenocarcinoma Antibodies  >309 publications with BID and Adenocarcinoma

Organs/Tissues associated with anti-BID antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >1710 publications with BID and Blood
 Liver Antibodies  >526 publications with BID and Liver
 Heart Antibodies  >490 publications with BID and Heart
 Lung Antibodies  >468 publications with BID and Lung
 Brain Antibodies  >337 publications with BID and Brain
 Vascular Antibodies  >294 publications with BID and Vascular
 Kidney Antibodies  >249 publications with BID and Kidney
 Skin Antibodies  >214 publications with BID and Skin
 Bone Antibodies  >193 publications with BID and Bone
 Stomach Antibodies  >165 publications with BID and Stomach
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000