• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BLNK Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146134

BLNK is a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BLNK, Monoclonal Antibody
Full Product Name
BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65) (FITC)
Product Gene Name
anti-BLNK antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human BLNK.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
44,451 Da
Immunogen
Partial recombinant corresponding to aa301-401 from human BLNK (AAH18906) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF*
Conjugate
FITC

Product Categories/Family for anti-BLNK antibody

Antibodies; B Cells
Applications Tested/Suitable for anti-BLNK antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-BLNK antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-BLNK antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-BLNK Monoclonal Antibody – Cat# MBS6146134

Testing Data of anti-BLNK antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and BLNK mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-BLNK Monoclonal Antibody, Testing Data – Cat# MBS6146134

Other Notes

Small volumes of anti-BLNK antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for BLNK purchase

MBS6146134 is an antibody targeting BLNK. Also known as BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for BLNK. It may not necessarily be applicable to this product.

NCBI GI #
33879057
NCBI GeneID
29760
NCBI Accession #
BC018906
NCBI Related Accession #
AAH18906
UniProt Secondary Accession #
O75498; O75499; Q2MD49
UniProt Related Accession #
Q8WV28
NCBI Official Full Name
Homo sapiens B-cell linker, mRNA
NCBI Official Synonym Full Names
B-cell linker
NCBI Official Symbol
BLNK
NCBI Official Synonym Symbols
bca; AGM4; BASH; LY57; SLP65; BLNK-S; SLP-65
Protein Family
B-cell linker protein
NCBI Protein Information
B-cell linker protein

NCBI Summary for BLNK

This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2012]
Show more

Research Articles on BLNK

1. vesicular signaling scaffolds are required for B cell activation indicates that vesicles may deliver preassembled signaling cargo to sites of BCR activation.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-BLNK antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Activates B Cell Receptor Leading To Generation Of Second Messengers Pathway antibodies  Antigen Activates B Cell Receptor Leading To Generation Of Second Messengers Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 BCR Signaling Pathway antibodies  BCR Signaling Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Interleukin-3, 5 And GM-CSF Signaling Pathway antibodies  Interleukin-3, 5 And GM-CSF Signaling Pathway Diagram
 NF-kappa B Signaling Pathway antibodies  NF-kappa B Signaling Pathway Diagram

Diseases associated with anti-BLNK antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >33 publications with BLNK and Neoplasms
 Cardiovascular Diseases Antibodies  >4 publications with BLNK and Cardiovascular Diseases
 Neoplasms, Experimental Antibodies  >2 publications with BLNK and Neoplasms, Experimental
 Disease Models, Animal Antibodies  >2 publications with BLNK and Disease Models, Animal
 Inflammation Antibodies  >2 publications with BLNK and Inflammation
 Liver Diseases Antibodies  >1 publications with BLNK and Liver Diseases
 Breast Neoplasms Antibodies  >1 publications with BLNK and Breast Neoplasms
 Carcinoma, Hepatocellular Antibodies  >1 publications with BLNK and Carcinoma, Hepatocellular
 Drug Toxicity Antibodies  >1 publications with BLNK and Drug Toxicity
 Necrosis Antibodies  >1 publications with BLNK and Necrosis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000