Mouse Anti-CENPN Monoclonal Antibody – Cat# MBS6146138

Western Blot detection against Immunogen (48.55kD).

CENPN Antibody – Mouse Monoclonal

Name: CENPN Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6146138
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146138

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CENPN, Monoclonal Antibody

Full Product Name

CENPN (Centromere Protein N, CENP-N, Interphase Centromere Complex Protein 32, C16orf60, ICEN32, BM-309, BM039, FLJ13607, FLJ22660) (FITC)

Product Gene Name

anti-CENPN antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

4A5-1C11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human BM039.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

Full length recombinant corresponding to aa1-205 from human BM039 (AAH07334) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN

Conjugate

FITC

Product Categories/Family for anti-CENPN antibody

Antibodies; Centromeres

Applications Tested/Suitable for anti-CENPN antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-CENPN antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CENPN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CENPN purchase

MBS6146138 is an antibody targeting CENPN. Also known as CENPN (Centromere Protein N, CENP-N, Interphase Centromere Complex Protein 32, C16orf60, ICEN32, BM-309, BM039, FLJ13607, FLJ22660) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CENPN. It may not necessarily be applicable to this product.

NCBI GI #

39645000

NCBI GeneID

55839

NCBI Accession #

BC007334

NCBI Related Accession #

AAH07334

UniProt Related Accession #

Q96H22

NCBI Official Full Name

Homo sapiens centromere protein N, mRNA

NCBI Official Synonym Full Names

centromere protein N

NCBI Official Symbol

CENPN

NCBI Official Synonym Symbols

BM039; CENP-N; ICEN32; C16orf60

Protein Family

Centromere protein

NCBI Protein Information

centromere protein N

NCBI Summary for CENPN

The protein encoded by this gene forms part of the nucleosome-associated complex and is important for kinetochore assembly. It is bound to kinetochores during S phase and G2 and recruits other proteins to the centromere. Pseudogenes of this gene are located on chromosome 2. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]

Research Articles on CENPN

1. CENP-N stabilizes CENP-A nucleosomes alone and additively with CENP-C in vitro. However, removal of CENP-C and CENP-N from cells, or mutating CENP-A so that it no longer interacts with CENP-C or CENP-N, had no effect on centromeric CENP-A stability in vivo. Thus, the stability of CENP-A nucleosomes in chromatin does not arise solely from its interactions with CENP-C or CENP-N.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.