• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BNIP3L Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146147

MBS6146147 is an antibody targeting BNIP3L. Also known as BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BNIP3L, Monoclonal Antibody
Full Product Name
BNIP3L (BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3-like, Adenovirus E1B19K-Binding Protein B5, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3A, NIP3-like Protein X, NIP3L, BNIP3A, BNIP3H, NIX) (FITC)
Product Gene Name
anti-BNIP3L antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human BNIP3L.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
19,559 Da
OMIM
605368
3D Structure
ModBase 3D Structure for O60238
Immunogen
Partial recombinant corresponding to aa43-130 from human BNIP3L (NP_004322) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Conjugate
FITC

Product Categories/Family for anti-BNIP3L antibody

Antibodies; Apoptosis
Applications Tested/Suitable for anti-BNIP3L antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-BNIP3L antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-BNIP3L antibody

Western Blot detection against Immunogen (35.42kD).
Mouse Anti-BNIP3L Monoclonal Antibody – Cat# MBS6146147

Immunofluorescence (IF) of anti-BNIP3L antibody

Immunofluorescence of monoclonal antibody to BNIP3L on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-BNIP3L Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6146147

Testing Data of anti-BNIP3L antibody

Detection limit for recombinant GST tagged BNIP3L is ~0.1ng/ml as a capture antibody.
Mouse Anti-BNIP3L Monoclonal Antibody, Testing Data – Cat# MBS6146147

Product References and Citations for anti-BNIP3L antibody

1. Identification of 14-3-3?^ as a Mieap-interacting protein and its role in mitochondrial quality control. Miyamoto T, Kitamura N, Ono M, Nakamura Y, Yoshida M, Kamino H, Murai R, Yamada T, Arakawa H.Sci Rep. 2012;2:379. Epub 2012 Apr 24. 2. BNIP3 and NIX Mediate Mieap-Induced Accumulation of Lysosomal Proteins within Mitochondria. Nakamura Y, Kitamura N, Shinogi D, Yoshida M, Goda O, Murai R, Kamino H, Arakawa H.PLoS One. 2012;7(1):e30767. Epub 2012 Jan 26.

Other Notes

Small volumes of anti-BNIP3L antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for BNIP3L. It may not necessarily be applicable to this product.

NCBI GI #
4757860
NCBI GeneID
665
NCBI Accession #
NP_004322
UniProt Primary Accession #
O60238
UniProt Secondary Accession #
Q5JW63; Q8NF87; B0AZS9
UniProt Related Accession #
O60238
GenBank Nucleotide #
NM_004331
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
NCBI Official Synonym Full Names
BCL2/adenovirus E1B 19kDa interacting protein 3-like
NCBI Official Symbol
BNIP3L
NCBI Official Synonym Symbols
NIX; BNIP3a
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
UniProt Synonym Protein Names
Adenovirus E1B19K-binding protein B5; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A; NIP3-like protein X; NIP3L
Protein Family
BCL2/adenovirus E1B 19 kDa protein-interacting protein
UniProt Gene Name
BNIP3L
UniProt Synonym Gene Names
BNIP3A; BNIP3H; NIX; NIP3L
UniProt Entry Name
BNI3L_HUMAN
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A; BCL2/adenovirus E1B 19-kd protein-interacting protein 3a; NIP3-like protein X; NIP3L; adenovirus E1B19k-binding protein B5

UniProt Comments for BNIP3L

BNIP3L: Induces apoptosis. Interacts with viral and cellular anti-apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. Inhibits apoptosis induced by BNIP3. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. May function as a tumor suppressor. Self-associates. Interacts with BNIP3 and STEAP3. Interacts with SPATA18/MIEAP. Interacts with human adenovirus-2 E1B 19 kDa protein. Belongs to the NIP3 family.

Protein type: Apoptosis; Membrane protein, integral; Mitochondrial; Endoplasmic reticulum; Nuclear envelope

Chromosomal Location of Human Ortholog: 8p21

Cellular Component: mitochondrial outer membrane; mitochondrion; endoplasmic reticulum; integral to membrane; nuclear envelope; intrinsic to membrane

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protein heterodimerization activity; lamin binding

Biological Process: viral reproduction; positive regulation of apoptosis; defense response to virus; negative regulation of apoptosis
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-BNIP3L antibody

 Reference Product  PubMed Publications
 BNIP3 antibody  >70 publications with BNIP3L and BNIP3
 BCL2 antibody  >12 publications with BNIP3L and BCL2
 BCL2L1 antibody  >10 publications with BNIP3L and BCL2L1
 TP53 antibody  >1 publications with BNIP3L and TP53
 CREBBP antibody  >1 publications with BNIP3L and CREBBP

Pathways associated with anti-BNIP3L antibody

 Products by Pathway  Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram

Diseases associated with anti-BNIP3L antibody

 Disease Name  Pubmed Publications
 Death Antibodies  >52 publications with BNIP3L and Death
 Neoplasms Antibodies  >42 publications with BNIP3L and Neoplasms
 Carcinoma Antibodies  >15 publications with BNIP3L and Carcinoma
 Cardiovascular Diseases Antibodies  >11 publications with BNIP3L and Cardiovascular Diseases
 Adenocarcinoma Antibodies  >11 publications with BNIP3L and Adenocarcinoma
 Breast Neoplasms Antibodies  >10 publications with BNIP3L and Breast Neoplasms
 Skin Diseases Antibodies  >10 publications with BNIP3L and Skin Diseases
 Necrosis Antibodies  >10 publications with BNIP3L and Necrosis
 Heart Failure Antibodies  >9 publications with BNIP3L and Heart Failure
 Hypertrophy Antibodies  >5 publications with BNIP3L and Hypertrophy

Organs/Tissues associated with anti-BNIP3L antibody

 Organ/Tissue Name  Pubmed Publications
 Heart Antibodies  >16 publications with BNIP3L and Heart
 Blood Antibodies  >15 publications with BNIP3L and Blood
 Muscle Antibodies  >10 publications with BNIP3L and Muscle
 Liver Antibodies  >8 publications with BNIP3L and Liver
 Lung Antibodies  >6 publications with BNIP3L and Lung
 Vascular Antibodies  >5 publications with BNIP3L and Vascular
 Kidney Antibodies  >4 publications with BNIP3L and Kidney
 Skin Antibodies  >3 publications with BNIP3L and Skin
 Prostate Antibodies  >3 publications with BNIP3L and Prostate
 Brain Antibodies  >3 publications with BNIP3L and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000