• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CRKL Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146660

MBS6146660 is an antibody targeting CRKL. Also known as CRKL (Crk-like Protein) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CRKL, Monoclonal Antibody
Full Product Name
CRKL (Crk-like Protein) (FITC)
Product Gene Name
anti-CRKL antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CRKL.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
35.9 kDa (323aa), confirmed by MALDI-TOF
OMIM
602007
3D Structure
ModBase 3D Structure for P46109
Immunogen
Partial recombinant corresponding to aa204-303 from human CRKL (NP_005198) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Conjugate
FITC

Product Categories/Family for anti-CRKL antibody

Antibodies; Disease Markers
Applications Tested/Suitable for anti-CRKL antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-CRKL antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CRKL antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-CRKL Monoclonal Antibody – Cat# MBS6146660

Immunofluorescence (IF) of anti-CRKL antibody

Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-CRKL Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6146660

Testing Data of anti-CRKL antibody

Detection limit for recombinant GST tagged CRKL is ~0.3ng/ml as a capture antibody.
Mouse Anti-CRKL Monoclonal Antibody, Testing Data – Cat# MBS6146660

Testing Data of anti-CRKL antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with GAB1 rabbit purified polyclonal 1:1200 and CRKL mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-CRKL Monoclonal Antibody, Testing Data – Cat# MBS6146660

Testing Data of anti-CRKL antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with PTK2 rabbit purified polyclonal 1:600 and CRKL mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex
Mouse Anti-CRKL Monoclonal Antibody, Testing Data – Cat# MBS6146660

Western Blot (WB) of anti-CRKL antibody

Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody. Lane 1: CRKL transfected lysate (33.8kD). Lane 2: Non-transfected lysate.
Mouse Anti-CRKL Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146660

Western Blot (WB) of anti-CRKL antibody

Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-CRKL Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146660

Product References and Citations for anti-CRKL antibody

1. PI3K Links NKG2D Signaling to a CrkL Pathway Involved in Natural Killer Cell Adhesion, Polarity, and Granule Secretion. Segovis CM, Schoon RA, Dick CJ, Nacusi LP, Leibson PJ, Billadeau DD.J Immunol. 2009 Jun 1;182(11):6933-42.

Other Notes

Small volumes of anti-CRKL antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CRKL. It may not necessarily be applicable to this product.

NCBI GI #
4885153
NCBI GeneID
1399
NCBI Accession #
NP_005198
UniProt Primary Accession #
P46109
UniProt Secondary Accession #
A8KA44; D3DX35
UniProt Related Accession #
P46109
GenBank Nucleotide #
NM_005207
NCBI Official Full Name
crk-like protein
NCBI Official Synonym Full Names
CRK like proto-oncogene, adaptor protein
NCBI Official Symbol
CRKL
UniProt Protein Name
Crk-like protein
Protein Family
Crk-like protein
UniProt Gene Name
CRKL
UniProt Entry Name
CRKL_HUMAN
NCBI Protein Information
crk-like protein

NCBI Summary for CRKL

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009]
Show more

UniProt Comments for CRKL

CRKL: an oncogenic adaptor protein with an SH2-SH3-SH3 domain structure. Plays a specific role in integrin-induced migration as a downstream mediator of Src. Activates the RAS and Jnk signaling pathways. Transforms fibroblasts in a RAS-dependent fashion. A substrate of BCR-ABL and plays a role in fibroblast transformation by BCR-ABL.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cytosol; endosome

Molecular Function: protein binding; signal transducer activity; SH3/SH2 adaptor activity

Biological Process: anterior/posterior pattern formation; blood vessel development; organ morphogenesis; nerve growth factor receptor signaling pathway; activation of MAPKK activity; thymus development; heart development; Ras protein signal transduction; JNK cascade; parathyroid gland development
Show more

Research Articles on CRKL

1. We demonstrated that CRKL is a novel downstream effector of ALK signaling in non-small-cell lung cancer

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CRKL antibody

 Reference Product  PubMed Publications
 BCR antibody  >144 publications with CRKL and BCR
 CRK antibody  >132 publications with CRKL and CRK
 CBL antibody  >67 publications with CRKL and CBL
 GRB2 antibody  >48 publications with CRKL and GRB2
 CD34 antibody  >25 publications with CRKL and CD34
 LYN antibody  >17 publications with CRKL and LYN
 DAB1 antibody  >13 publications with CRKL and DAB1
 SYK antibody  >11 publications with CRKL and SYK
 BCAR1 antibody  >9 publications with CRKL and BCAR1
 PXN antibody  >9 publications with CRKL and PXN

Pathways associated with anti-CRKL antibody

 Products by Pathway  Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 Bacterial Invasion Of Epithelial Cells Pathway antibodies  Bacterial Invasion Of Epithelial Cells Pathway Diagram
 Bacterial Invasion Of Epithelial Cells Pathway antibodies  Bacterial Invasion Of Epithelial Cells Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram
 Chronic Myeloid Leukemia Pathway antibodies  Chronic Myeloid Leukemia Pathway Diagram
 Chronic Myeloid Leukemia Pathway antibodies  Chronic Myeloid Leukemia Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Downstream Signal Transduction Pathway antibodies  Downstream Signal Transduction Pathway Diagram
 EGF/EGFR Signaling Pathway antibodies  EGF/EGFR Signaling Pathway Diagram

Diseases associated with anti-CRKL antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >142 publications with CRKL and Neoplasms
 Leukemia, Myelogenous, Chronic, BCR-ABL Positive Antibodies  >83 publications with CRKL and Leukemia, Myelogenous, Chronic, BCR-ABL Positive
 Heart Defects, Congenital Antibodies  >12 publications with CRKL and Heart Defects, Congenital
 Disease Models, Animal Antibodies  >11 publications with CRKL and Disease Models, Animal
 Leukemia, Myeloid, Acute Antibodies  >11 publications with CRKL and Leukemia, Myeloid, Acute
 Craniofacial Abnormalities Antibodies  >10 publications with CRKL and Craniofacial Abnormalities
 DiGeorge Syndrome Antibodies  >10 publications with CRKL and DiGeorge Syndrome
 Neoplasms, Experimental Antibodies  >7 publications with CRKL and Neoplasms, Experimental
 Breast Neoplasms Antibodies  >5 publications with CRKL and Breast Neoplasms
 Inflammation Antibodies  >4 publications with CRKL and Inflammation

Organs/Tissues associated with anti-CRKL antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >100 publications with CRKL and Blood
 Bone Antibodies  >20 publications with CRKL and Bone
 Nerve Antibodies  >19 publications with CRKL and Nerve
 Bone Marrow Antibodies  >18 publications with CRKL and Bone Marrow
 Brain Antibodies  >15 publications with CRKL and Brain
 Embryonic Tissue Antibodies  >12 publications with CRKL and Embryonic Tissue
 Lung Antibodies  >11 publications with CRKL and Lung
 Heart Antibodies  >7 publications with CRKL and Heart
 Stomach Antibodies  >5 publications with CRKL and Stomach
 Thymus Antibodies  >4 publications with CRKL and Thymus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000