• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Cyclophilin E (PPIE) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146736

MBS6146736 is an antibody targeting PPIE. Also known as Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (FITC). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Cyclophilin E (PPIE), Monoclonal Antibody
Full Product Name
Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (FITC)
Product Gene Name
anti-PPIE antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F5
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PPIE. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
34,991 Da
OMIM
602435
3D Structure
ModBase 3D Structure for Q9UNP9
Immunogen
Partial recombinant corresponding to aa2-100 from PPIE (NP_006103) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Conjugate
FITC

Product Categories/Family for anti-PPIE antibody

Antibodies; Cyclophilin
Applications Tested/Suitable for anti-PPIE antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-PPIE antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PPIE antibody

PPIE monoclonal antibody Western Blot analysis of PPIE expression in Raw 264.7.
Mouse Anti-PPIE Monoclonal Antibody – Cat# MBS6146736

Western Blot (WB) of anti-PPIE antibody

PPIE monoclonal antibody Western Blot analysis of PPIE expression in NIH/3T3.
Mouse Anti-PPIE Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146736

Western Blot (WB) of anti-PPIE antibody

Western Blot analysis of PPIE expression in transfected 293T cell line by PPIE monoclonal antibody. Lane 1: PPIE transfected lysate (33.4kD). Lane 2: Non-transfected lysate.
Mouse Anti-PPIE Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146736

Immunofluorescence (IF) of anti-PPIE antibody

Immunofluorescence of monoclonal antibody to PPIE on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-PPIE Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6146736

Testing Data of anti-PPIE antibody

Detection limit for recombinant GST tagged PPIE is ~0.1ng/ml as a capture antibody.
Mouse Anti-PPIE Monoclonal Antibody, Testing Data – Cat# MBS6146736

Western Blot (WB) of anti-PPIE antibody

PPIE monoclonal antibody Western Blot analysis of PPIE expression in Hela NE.
Mouse Anti-PPIE Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146736

Western Blot (WB) of anti-PPIE antibody

PPIE monoclonal antibody Western Blot analysis of PPIE expression in PC-12.
Mouse Anti-PPIE Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146736

Other Notes

Small volumes of anti-PPIE antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PPIE. It may not necessarily be applicable to this product.

NCBI GI #
5174637
NCBI GeneID
10450
NCBI Accession #
NP_006103
UniProt Primary Accession #
Q9UNP9
UniProt Secondary Accession #
O43634; O43635; Q32Q72; Q3S611; Q5TGA0; Q5TGA2; Q5TGA3; Q9UIZ5; B2R971
UniProt Related Accession #
Q9UNP9
GenBank Nucleotide #
NM_006112
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase E isoform 1
NCBI Official Synonym Full Names
peptidylprolyl isomerase E
NCBI Official Symbol
PPIE
NCBI Official Synonym Symbols
CYP33; CYP-33
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase E
UniProt Synonym Protein Names
Cyclophilin E; Cyclophilin-33; Rotamase E
Protein Family
Peptidyl-prolyl cis-trans isomerase
UniProt Gene Name
PPIE
UniProt Synonym Gene Names
CYP33; PPIase E
UniProt Entry Name
PPIE_HUMAN
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase E

NCBI Summary for PPIE

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 1, has been identified. [provided by RefSeq, Aug 2010]
Show more

UniProt Comments for PPIE

PPIE: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing. Belongs to the cyclophilin-type PPIase family. PPIase E subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Isomerase; Spliceosome; RNA splicing; EC 5.2.1.8; Cyclophilin

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: nucleus

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; RNA binding; nucleotide binding; cyclosporin A binding

Biological Process: nuclear mRNA splicing, via spliceosome; protein peptidyl-prolyl isomerization; positive regulation of viral genome replication; protein folding; regulation of transcription, DNA-dependent
Show more

Research Articles on PPIE

1. CypE is a host restriction factor that inhibits the functions of nucleoprotein, as well as viral replication and transcription, by impairing the formation of the viral ribonucleoprotein complex.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PPIE antibody

 Reference Product  PubMed Publications
 MLL antibody  >5 publications with PPIE and MLL
 XAB2 antibody  >1 publications with PPIE and XAB2

Pathways associated with anti-PPIE antibody

 Products by Pathway  Pathway Diagram
 DNA Repair Pathway antibodies  DNA Repair Pathway Diagram
 Dual Incision In TC-NER Pathway antibodies  Dual Incision In TC-NER Pathway Diagram
 Formation Of TC-NER Pre-Incision Complex Pathway antibodies  Formation Of TC-NER Pre-Incision Complex Pathway Diagram
 Gap-filling DNA Repair Synthesis And Ligation In TC-NER Pathway antibodies  Gap-filling DNA Repair Synthesis And Ligation In TC-NER Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Innate Immune System Pathway antibodies  Innate Immune System Pathway Diagram
 Neutrophil Degranulation Pathway antibodies  Neutrophil Degranulation Pathway Diagram
 Nucleotide Excision Repair Pathway antibodies  Nucleotide Excision Repair Pathway Diagram
 Processing Of Capped Intron-Containing Pre-mRNA Pathway antibodies  Processing Of Capped Intron-Containing Pre-mRNA Pathway Diagram

Diseases associated with anti-PPIE antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >3 publications with PPIE and Nervous System Diseases
 Brain Diseases Antibodies  >3 publications with PPIE and Brain Diseases
 Adenocarcinoma Antibodies  >1 publications with PPIE and Adenocarcinoma
 Cognition Disorders Antibodies  >1 publications with PPIE and Cognition Disorders
 Necrosis Antibodies  >1 publications with PPIE and Necrosis

Organs/Tissues associated with anti-PPIE antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >4 publications with PPIE and Lung
 Brain Antibodies  >4 publications with PPIE and Brain
 Kidney Antibodies  >2 publications with PPIE and Kidney
 Blood Antibodies  >2 publications with PPIE and Blood
 Esophagus Antibodies  >1 publications with PPIE and Esophagus
 Muscle Antibodies  >1 publications with PPIE and Muscle
 Skin Antibodies  >1 publications with PPIE and Skin
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000