• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DECR1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146813

MBS6146813 is an antibody targeting DECR1. Also known as DECR1 (2,4 Dienoyl CoA Reductase 1 Mitochondrial, DECR, Short Chain Dehydrogenase/reductase Family 18C Member 1, SDR18C1) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DECR1, Monoclonal Antibody
Full Product Name
DECR1 (2,4 Dienoyl CoA Reductase 1 Mitochondrial, DECR, Short Chain Dehydrogenase/reductase Family 18C Member 1, SDR18C1) (FITC)
Product Gene Name
anti-DECR1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human DECR1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
34,994 Da
OMIM
222745
3D Structure
ModBase 3D Structure for Q16698
Immunogen
Partial recombinant corresponding to aa236-335 from human DECR1 (NP_001350) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Conjugate
FITC

Product Categories/Family for anti-DECR1 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-DECR1 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-DECR1 antibody
Sandwich ELISA: The detection limit is 0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-DECR1 antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-DECR1 Monoclonal Antibody – Cat# MBS6146813

Western Blot (WB) of anti-DECR1 antibody

DECR1 monoclonal antibody Western Blot analysis of DECR1 expression in HepG2.
Mouse Anti-DECR1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146813

Immunohistochemistry (IHC) of anti-DECR1 antibody

Immunoperoxidase of monoclonal antibody to DECR1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].
Mouse Anti-DECR1 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6146813

Testing Data of anti-DECR1 antibody

Detection limit for recombinant GST tagged DECR1 is 0.3ng/ml as a capture antibody.
Mouse Anti-DECR1 Monoclonal Antibody, Testing Data – Cat# MBS6146813

Other Notes

Small volumes of anti-DECR1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for DECR1. It may not necessarily be applicable to this product.

NCBI GI #
4503301
NCBI GeneID
1666
NCBI Accession #
NP_001350
UniProt Primary Accession #
Q16698
UniProt Secondary Accession #
Q2M304; Q93085; B7Z6B8
UniProt Related Accession #
Q16698
GenBank Nucleotide #
NM_001359
NCBI Official Full Name
2,4-dienoyl-CoA reductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
2,4-dienoyl-CoA reductase 1
NCBI Official Symbol
DECR1
NCBI Official Synonym Symbols
DECR; NADPH; SDR18C1
UniProt Protein Name
2,4-dienoyl-CoA reductase, mitochondrial
UniProt Synonym Protein Names
2,4-dienoyl-CoA reductase [NADPH]; 4-enoyl-CoA reductase [NADPH]; Short chain dehydrogenase/reductase family 18C member 1
Protein Family
2,4-dienoyl-CoA reductase
UniProt Gene Name
DECR1
UniProt Synonym Gene Names
DECR; SDR18C1; 4-enoyl-CoA reductase [NADPH]
UniProt Entry Name
DECR_HUMAN
NCBI Protein Information
2,4-dienoyl-CoA reductase, mitochondrial

NCBI Summary for DECR1

This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]

UniProt Comments for DECR1

DECR1: Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3- enoyl-CoA. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

Protein type: Oxidoreductase; Mitochondrial; EC 1.3.1.34

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm; nucleus

Molecular Function: oxidoreductase activity, acting on NADH or NADPH; 2,4-dienoyl-CoA reductase (NADPH) activity

Biological Process: fatty acid beta-oxidation; cellular lipid metabolic process; protein homotetramerization
Show more

Research Articles on DECR1

1. Our study is the first to demonstrate the novel function of UA in NET formation and may provide insight into the management of patients with hyperuricemia.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-DECR1 antibody

 Products by Pathway  Pathway Diagram
 Fatty Acid Beta Oxidation Pathway antibodies  Fatty Acid Beta Oxidation Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway antibodies  Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 Mitochondrial Fatty Acid Beta-Oxidation Pathway antibodies  Mitochondrial Fatty Acid Beta-Oxidation Pathway Diagram
 Mitochondrial Fatty Acid Beta-oxidation Of Unsaturated Fatty Acids Pathway antibodies  Mitochondrial Fatty Acid Beta-oxidation Of Unsaturated Fatty Acids Pathway Diagram

Diseases associated with anti-DECR1 antibody

 Disease Name  Pubmed Publications
 Cell Transformation, Neoplastic Antibodies  >1 publications with DECR1 and Cell Transformation, Neoplastic
 Neoplasms, Experimental Antibodies  >1 publications with DECR1 and Neoplasms, Experimental
 Disease Models, Animal Antibodies  >1 publications with DECR1 and Disease Models, Animal
 Fatty Liver Antibodies  >1 publications with DECR1 and Fatty Liver
 Necrosis Antibodies  >1 publications with DECR1 and Necrosis

Organs/Tissues associated with anti-DECR1 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >3 publications with DECR1 and Muscle
 Connective Tissue Antibodies  >2 publications with DECR1 and Connective Tissue
 Blood Antibodies  >1 publications with DECR1 and Blood
 Ovary Antibodies  >1 publications with DECR1 and Ovary
 Mammary Gland Antibodies  >1 publications with DECR1 and Mammary Gland
 Heart Antibodies  >1 publications with DECR1 and Heart
 Liver Antibodies  >1 publications with DECR1 and Liver
 Uterus Antibodies  >1 publications with DECR1 and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000