• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DIO-1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146846

Apoptosis plays an important role in many cellular processes. Dio-1 (Death Inducer-O bliterator-1), a putative transcription factor, has been indicated to function in the onset of apoptosis. Dio-1 expression is upregulated when an apoptosis is detected. It… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DIO-1, Monoclonal Antibody
Full Product Name
DIO-1 (Death-inducer Obliterator 1, hDido1, Death-associated Transcription Factor 1, DATF-1, DIDO1, C20orf158, DATF1, KIAA0333) (FITC)
Product Gene Name
anti-DIO-1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human DIDO1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa321-420 from human DIDO1 (AAH14489) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Conjugate
FITC

Product Categories/Family for anti-DIO-1 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-DIO-1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-DIO-1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-DIO-1 antibody

Western Blot detection against Immunogen (37kD).
Mouse Anti-DIO-1 Monoclonal Antibody – Cat# MBS6146846

Western Blot (WB) of anti-DIO-1 antibody

DIDO1 monoclonal antibody. Western Blot analysis of DIDO1 expression in HepG2.
Mouse Anti-DIO-1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146846

Testing Data of anti-DIO-1 antibody

Detection limit for recombinant GST tagged DIDO1 is 0.03ng/ml as a capture antibody.
Mouse Anti-DIO-1 Monoclonal Antibody, Testing Data – Cat# MBS6146846

Other Notes

Small volumes of anti-DIO-1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DIO-1 purchase

MBS6146846 is an antibody targeting DIO-1. Also known as DIO-1 (Death-inducer Obliterator 1, hDido1, Death-associated Transcription Factor 1, DATF-1, DIDO1, C20orf158, DATF1, KIAA0333) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DIO-1. It may not necessarily be applicable to this product.

NCBI GI #
15680266
NCBI GeneID
11083
NCBI Accession #
BC014489
NCBI Related Accession #
AAH14489
UniProt Related Accession #
Q9BTC0
NCBI Official Full Name
Homo sapiens death inducer-obliterator 1, mRNA
NCBI Official Synonym Full Names
death inducer-obliterator 1
NCBI Official Symbol
DIDO1
NCBI Official Synonym Symbols
BYE1; DIO1; DATF1; DIDO2; DIDO3; DIO-1; DATF-1; C20orf158; dJ885L7.8
Protein Family
Death-inducer obliterator
NCBI Protein Information
death-inducer obliterator 1

NCBI Summary for DIO-1

Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq, Jul 2008]
Show more

Research Articles on DIO-1

1. Results identified a novel pH-dependent mechanism by which epigenetic reader, the PHD fingers of DIDO, recognize the histone mark H3K4me3. The pH-sensing ability might be necessary for normal biological processes and those characterized by altered cellular pH.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000