• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DOCK1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146895

DOCK1 binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DOCK1, Monoclonal Antibody
Full Product Name
DOCK1 (Dedicator of Cytokinesis Protein 1, 180kD Protein Downstream of CRK, DOCK180) (FITC)
Product Gene Name
anti-DOCK1 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human DOCK1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
215,346 Da
OMIM
601403
3D Structure
ModBase 3D Structure for Q14185
Immunogen
Partial recombinant corresponding to aa698-803 from human DOCK1 (NP_001371) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT
Conjugate
FITC

Product Categories/Family for anti-DOCK1 antibody

Antibodies; Apoptosis
Applications Tested/Suitable for anti-DOCK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-DOCK1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-DOCK1 antibody

DOCK1 monoclonal antibody. Western Blot analysis of DOCK1 expression in human colon.
Mouse Anti-DOCK1 Monoclonal Antibody – Cat# MBS6146895

Other Notes

Small volumes of anti-DOCK1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DOCK1 purchase

MBS6146895 is an antibody targeting DOCK1. Also known as DOCK1 (Dedicator of Cytokinesis Protein 1, 180kD Protein Downstream of CRK, DOCK180) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DOCK1. It may not necessarily be applicable to this product.

NCBI GI #
4503355
NCBI GeneID
1793
NCBI Accession #
NP_001371
UniProt Primary Accession #
Q14185
UniProt Secondary Accession #
A9Z1Z5
UniProt Related Accession #
Q14185
GenBank Nucleotide #
NM_001380
NCBI Official Full Name
dedicator of cytokinesis protein 1 isoform 2
NCBI Official Synonym Full Names
dedicator of cytokinesis 1
NCBI Official Symbol
DOCK1
NCBI Official Synonym Symbols
ced5; DOCK180
UniProt Protein Name
Dedicator of cytokinesis protein 1
UniProt Synonym Protein Names
180 kDa protein downstream of CRK
Protein Family
Dedicator of cytokinesis protein
UniProt Gene Name
DOCK1
UniProt Synonym Gene Names
DOCK180
UniProt Entry Name
DOCK1_HUMAN
NCBI Protein Information
dedicator of cytokinesis protein 1; 180 kDa protein downstream of CRK; DOwnstream of CrK

UniProt Comments for DOCK1

DOCK1: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1. Interacts with the SH3 domains of CRK and NCK2 via multiple sites. Interacts with nucleotide-free RAC1 via its DHR-2 domain. Interacts with ELMO1, ELMO2 and probably ELMO3 via its SH3 domain. Interacts with RAC1 and BAI1. Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon. Belongs to the DOCK family.

Protein type: GEFs, Rac/Rho; Cytoskeletal; Motility/polarity/chemotaxis; Adaptor/scaffold; GEFs

Chromosomal Location of Human Ortholog: 10q26.13-q26.3

Cellular Component: nucleoplasm; membrane; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity; SH3 domain binding; GTPase activator activity

Biological Process: integrin-mediated signaling pathway; axon guidance; cell migration; apoptosis; small GTPase mediated signal transduction; innate immune response; hemopoietic progenitor cell differentiation; vascular endothelial growth factor receptor signaling pathway; blood coagulation; signal transduction; phagocytosis, engulfment; positive regulation of GTPase activity
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DOCK1 antibody

 Reference Product  PubMed Publications
 CRK antibody  >34 publications with DOCK1 and CRK
 RAC1 antibody  >27 publications with DOCK1 and RAC1
 ELMO1 antibody  >24 publications with DOCK1 and ELMO1
 RHOG antibody  >8 publications with DOCK1 and RHOG
 BCAR1 antibody  >5 publications with DOCK1 and BCAR1
 ELMO2 antibody  >2 publications with DOCK1 and ELMO2
 JMJD6 antibody  >1 publications with DOCK1 and JMJD6

Pathways associated with anti-DOCK1 antibody

 Products by Pathway  Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Bacterial Invasion Of Epithelial Cells Pathway antibodies  Bacterial Invasion Of Epithelial Cells Pathway Diagram
 Bacterial Invasion Of Epithelial Cells Pathway antibodies  Bacterial Invasion Of Epithelial Cells Pathway Diagram
 DCC Mediated Attractive Signaling Pathway antibodies  DCC Mediated Attractive Signaling Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Factors Involved In Megakaryocyte Development And Platelet Production Pathway antibodies  Factors Involved In Megakaryocyte Development And Platelet Production Pathway Diagram
 Fcgamma Receptor (FCGR) Dependent Phagocytosis Pathway antibodies  Fcgamma Receptor (FCGR) Dependent Phagocytosis Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram

Diseases associated with anti-DOCK1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >11 publications with DOCK1 and Neoplasms
 Ovarian Neoplasms Antibodies  >2 publications with DOCK1 and Ovarian Neoplasms
 Immune System Diseases Antibodies  >2 publications with DOCK1 and Immune System Diseases
 Ovarian Diseases Antibodies  >2 publications with DOCK1 and Ovarian Diseases
 Brain Diseases Antibodies  >2 publications with DOCK1 and Brain Diseases
 Craniofacial Abnormalities Antibodies  >1 publications with DOCK1 and Craniofacial Abnormalities
 Lymphoma Antibodies  >1 publications with DOCK1 and Lymphoma
 Neoplasms, Experimental Antibodies  >1 publications with DOCK1 and Neoplasms, Experimental
 Cell Transformation, Neoplastic Antibodies  >1 publications with DOCK1 and Cell Transformation, Neoplastic
 Lung Diseases Antibodies  >1 publications with DOCK1 and Lung Diseases

Organs/Tissues associated with anti-DOCK1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >7 publications with DOCK1 and Brain
 Embryonic Tissue Antibodies  >4 publications with DOCK1 and Embryonic Tissue
 Muscle Antibodies  >3 publications with DOCK1 and Muscle
 Kidney Antibodies  >3 publications with DOCK1 and Kidney
 Nerve Antibodies  >3 publications with DOCK1 and Nerve
 Vascular Antibodies  >2 publications with DOCK1 and Vascular
 Eye Antibodies  >2 publications with DOCK1 and Eye
 Thymus Antibodies  >1 publications with DOCK1 and Thymus
 Testis Antibodies  >1 publications with DOCK1 and Testis
 Mammary Gland Antibodies  >1 publications with DOCK1 and Mammary Gland
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000