• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GMPPA Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147410

MBS6147410 is an antibody targeting GMPPA. Also known as GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) (FITC). Reactive in Human. Host: Mouse. GTP + alpha-D-mannose… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GMPPA, Monoclonal Antibody
Full Product Name
GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) (FITC)
Product Gene Name
anti-GMPPA antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GMPPA.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
3D Structure
ModBase 3D Structure for Q96IJ6
Immunogen
Partial recombinant corresponding to aa321-421 from human GMPPA (NP_037467) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL*
Conjugate
FITC

Product Categories/Family for anti-GMPPA antibody

Antibodies; Enzymes; Phosphorylase
Applications Tested/Suitable for anti-GMPPA antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GMPPA antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GMPPA antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-GMPPA Monoclonal Antibody – Cat# MBS6147410

Western Blot (WB) of anti-GMPPA antibody

Western Blot analysis of GMPPA expression in transfected 293T cell line by GMPPA monoclonal antibody. Lane 1: GMPPA transfected lysate (46.291kD). Lane 2: Non-transfected lysate.
Mouse Anti-GMPPA Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147410

Immunoprecipitation (IP) of anti-GMPPA antibody

Immunoprecipitation of GMPPA transfected lysate using GMPPA monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GMPPA monoclonal antibody.
Mouse Anti-GMPPA Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6147410

Other Notes

Small volumes of anti-GMPPA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for GMPPA. It may not necessarily be applicable to this product.

NCBI GI #
31881779
NCBI GeneID
29926
NCBI Accession #
NP_037467
UniProt Primary Accession #
Q96IJ6
UniProt Related Accession #
Q96IJ6
GenBank Nucleotide #
NM_013335
NCBI Official Full Name
mannose-1-phosphate guanyltransferase alpha
NCBI Official Synonym Full Names
GDP-mannose pyrophosphorylase A
NCBI Official Symbol
GMPPA
NCBI Official Synonym Symbols
AAMR
UniProt Protein Name
Mannose-1-phosphate guanyltransferase alpha
UniProt Synonym Protein Names
GDP-mannose pyrophosphorylase A; GTP-mannose-1-phosphate guanylyltransferase alpha
Protein Family
Mannose-1-phosphate guanyltransferase
UniProt Gene Name
GMPPA
UniProt Entry Name
GMPPA_HUMAN
NCBI Protein Information
mannose-1-phosphate guanyltransferase alpha

NCBI Summary for GMPPA

This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008]

UniProt Comments for GMPPA

GMPPA: This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008]

Protein type: Transferase; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Carbohydrate Metabolism - fructose and mannose; EC 2.7.7.13

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cytoplasm

Molecular Function: nucleotidyltransferase activity

Biological Process: cellular protein metabolic process; dolichol-linked oligosaccharide biosynthetic process; GDP-mannose biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Disease: Alacrima, Achalasia, And Mental Retardation Syndrome
Show more

Research Articles on GMPPA

1. Based on our findings and the previous report describing patients with an overlapping phenotype, we conclude that this novel variant in GMPPA, identified by exome sequencing in the proband and her affected sister, is the genetic cause of their phenotype and may expand the known phenotype of this recently described glycosylation disorder.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-GMPPA antibody

 Products by Pathway  Pathway Diagram
 Amino Sugar And Nucleotide Sugar Metabolism Pathway antibodies  Amino Sugar And Nucleotide Sugar Metabolism Pathway Diagram
 Amino Sugar And Nucleotide Sugar Metabolism Pathway antibodies  Amino Sugar And Nucleotide Sugar Metabolism Pathway Diagram
 Asparagine N-linked Glycosylation Pathway antibodies  Asparagine N-linked Glycosylation Pathway Diagram
 Biosynthesis Of The N-glycan Precursor (dolichol Lipid-linked Oligosaccharide, LLO) And Transfer To A Nascent Protein Pathway antibodies  Biosynthesis Of The N-glycan Precursor (dolichol Lipid-linked Oligosaccharide, LLO) And Transfer To A Nascent Protein Pathway Diagram
 Fructose And Mannose Metabolism Pathway antibodies  Fructose And Mannose Metabolism Pathway Diagram
 Fructose And Mannose Metabolism Pathway antibodies  Fructose And Mannose Metabolism Pathway Diagram
 GDP-mannose Biosynthesis Pathway antibodies  GDP-mannose Biosynthesis Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Nucleotide Sugar Biosynthesis, Eukaryotes Pathway antibodies  Nucleotide Sugar Biosynthesis, Eukaryotes Pathway Diagram
 Nucleotide Sugar Biosynthesis, Eukaryotes Pathway antibodies  Nucleotide Sugar Biosynthesis, Eukaryotes Pathway Diagram

Organs/Tissues associated with anti-GMPPA antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >1 publications with GMPPA and Bone
 Bone Marrow Antibodies  >1 publications with GMPPA and Bone Marrow
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000