• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GNAQ Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147418

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GNAQ, Monoclonal Antibody
Full Product Name
GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha, Guanine Nucleotide-binding Protein alpha-q, GAQ) (FITC)
Product Gene Name
anti-GNAQ antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B9
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GNAQ. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
42,142 Da
OMIM
163000
3D Structure
ModBase 3D Structure for P50148
Immunogen
Partial recombinant corresponding to aa101-200 from human GNAQ (NP_002063) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVI
Conjugate
FITC

Product Categories/Family for anti-GNAQ antibody

Antibodies; G Proteins
Applications Tested/Suitable for anti-GNAQ antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GNAQ antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GNAQ antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-GNAQ Monoclonal Antibody – Cat# MBS6147418

Testing Data of anti-GNAQ antibody

Detection limit for recombinant GST tagged GNAQ is 1ng/ml as a capture antibody.
Mouse Anti-GNAQ Monoclonal Antibody, Testing Data – Cat# MBS6147418

Other Notes

Small volumes of anti-GNAQ antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GNAQ purchase

MBS6147418 is an antibody targeting GNAQ. Also known as GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha, Guanine Nucleotide-binding Protein alpha-q, GAQ) (FITC). Reactive in Human, Mouse, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GNAQ. It may not necessarily be applicable to this product.

NCBI GI #
40254462
NCBI GeneID
2776
NCBI Accession #
NP_002063.2
UniProt Primary Accession #
P50148
UniProt Secondary Accession #
O15108; Q13462; Q6NT27; Q92471; Q9BZB9
UniProt Related Accession #
P50148
GenBank Nucleotide #
NM_002072
NCBI Official Full Name
guanine nucleotide-binding protein G(q) subunit alpha
NCBI Official Synonym Full Names
G protein subunit alpha q
NCBI Official Symbol
GNAQ
NCBI Official Synonym Symbols
GAQ; SWS; CMC1; G-ALPHA-q
UniProt Protein Name
Guanine nucleotide-binding protein G(q) subunit alpha
UniProt Synonym Protein Names
Guanine nucleotide-binding protein alpha-q
UniProt Gene Name
GNAQ
UniProt Synonym Gene Names
GAQ
UniProt Entry Name
GNAQ_HUMAN
NCBI Protein Information
guanine nucleotide-binding protein G(q) subunit alpha

UniProt Comments for GNAQ

G-alpha(q): a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Agonist binding to Gq-coupled receptors may block Akt activation via the release of active G-alpha(q) subunits that inhibit phosphatidylinositol 3-kinase. Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.

Protein type: G protein; G protein, heterotrimeric; G protein, heterotrimeric alpha G(q)

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: cytoplasm; lysosomal membrane; photoreceptor outer segment; plasma membrane

Molecular Function: GTPase activator activity; GTPase activity; protein binding; type 2A serotonin receptor binding

Biological Process: acetylcholine receptor signaling, muscarinic pathway; blood coagulation; dopamine receptor, phospholipase C activating pathway; entrainment of circadian clock; G-protein signaling, adenylate cyclase activating pathway; glutamate signaling pathway; negative regulation of protein kinase activity; phospholipase C activation; phototransduction, visible light; platelet activation; protein stabilization; regulation of action potential

Disease: Capillary Malformations, Congenital; Sturge-weber Syndrome
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GNAQ antibody

 Reference Product  PubMed Publications
 PLCB3 antibody  >2 publications with GNAQ and PLCB3
 PLCB1 antibody  >2 publications with GNAQ and PLCB1
 PLCB2 antibody  >1 publications with GNAQ and PLCB2

Pathways associated with anti-GNAQ antibody

 Products by Pathway  Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 1 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 1 Pathway Diagram
 Acetylcholine Regulates Insulin Secretion Pathway antibodies  Acetylcholine Regulates Insulin Secretion Pathway Diagram
 Adrenergic Signaling In Cardiomyocytes Pathway antibodies  Adrenergic Signaling In Cardiomyocytes Pathway Diagram
 Adrenergic Signaling In Cardiomyocytes Pathway antibodies  Adrenergic Signaling In Cardiomyocytes Pathway Diagram
 African Trypanosomiasis Pathway antibodies  African Trypanosomiasis Pathway Diagram
 African Trypanosomiasis Pathway antibodies  African Trypanosomiasis Pathway Diagram
 Aldosterone Synthesis And Secretion Pathway antibodies  Aldosterone Synthesis And Secretion Pathway Diagram
 Aldosterone Synthesis And Secretion Pathway antibodies  Aldosterone Synthesis And Secretion Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram

Diseases associated with anti-GNAQ antibody

 Disease Name  Pubmed Publications
 Melanoma Antibodies  >165 publications with GNAQ and Melanoma
 Uveal melanoma Antibodies  >95 publications with GNAQ and Uveal melanoma
 Nervous System Diseases Antibodies  >18 publications with GNAQ and Nervous System Diseases
 Sturge-Weber Syndrome Antibodies  >15 publications with GNAQ and Sturge-Weber Syndrome
 Cell Transformation, Neoplastic Antibodies  >7 publications with GNAQ and Cell Transformation, Neoplastic
 Liver Diseases Antibodies  >6 publications with GNAQ and Liver Diseases
 Port-Wine Stain Antibodies  >6 publications with GNAQ and Port-Wine Stain
 Neoplasms, Experimental Antibodies  >6 publications with GNAQ and Neoplasms, Experimental
 Lung Neoplasms Antibodies  >6 publications with GNAQ and Lung Neoplasms
 Brain Diseases Antibodies  >5 publications with GNAQ and Brain Diseases

Organs/Tissues associated with anti-GNAQ antibody

 Organ/Tissue Name  Pubmed Publications
 Skin Antibodies  >63 publications with GNAQ and Skin
 Eye Antibodies  >42 publications with GNAQ and Eye
 Blood Antibodies  >26 publications with GNAQ and Blood
 Brain Antibodies  >22 publications with GNAQ and Brain
 Vascular Antibodies  >18 publications with GNAQ and Vascular
 Liver Antibodies  >17 publications with GNAQ and Liver
 Lung Antibodies  >9 publications with GNAQ and Lung
 Thyroid Antibodies  >7 publications with GNAQ and Thyroid
 Ear Antibodies  >6 publications with GNAQ and Ear
 Kidney Antibodies  >5 publications with GNAQ and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000