• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GNB5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147420

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GNB5, Monoclonal Antibody
Full Product Name
GNB5 (Gbeta5, Transducin beta Chain 5, Guanine Nucleotide-binding Protein Subunit beta-5, FLJ37457, FLJ43714, GB5) (FITC)
Product Gene Name
anti-GNB5 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GNB5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
43kDa
OMIM
604447
3D Structure
ModBase 3D Structure for O14775
Immunogen
Partial recombinant corresponding to aa1-90 from human GNB5 (NP_057278) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEAL
Conjugate
FITC

Product Categories/Family for anti-GNB5 antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-GNB5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GNB5 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GNB5 antibody

Western Blot detection against Immunogen (36.01kD).
Mouse Anti-GNB5 Monoclonal Antibody – Cat# MBS6147420

Western Blot (WB) of anti-GNB5 antibody

Western Blot analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody Lane 1: GNB5 transfected lysate (38.8kD). Lane 2: Non-transfected lysate.
Mouse Anti-GNB5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147420

Testing Data of anti-GNB5 antibody

Detection limit for recombinant GST tagged GNB5 is 0.1ng/ml as a capture antibody.
Mouse Anti-GNB5 Monoclonal Antibody, Testing Data – Cat# MBS6147420

Testing Data of anti-GNB5 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with GNG7 rabbit purified polyclonal 1:1200 and GNB5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-GNB5 Monoclonal Antibody, Testing Data – Cat# MBS6147420

Other Notes

Small volumes of anti-GNB5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GNB5 purchase

MBS6147420 is an antibody targeting GNB5. Also known as GNB5 (Gbeta5, Transducin beta Chain 5, Guanine Nucleotide-binding Protein Subunit beta-5, FLJ37457, FLJ43714, GB5) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GNB5. It may not necessarily be applicable to this product.

NCBI GI #
20336270
NCBI GeneID
10681
NCBI Accession #
NP_057278
UniProt Primary Accession #
O14775
UniProt Related Accession #
O14775
GenBank Nucleotide #
NM_016194
NCBI Official Full Name
guanine nucleotide-binding protein subunit beta-5 isoform b
NCBI Official Synonym Full Names
G protein subunit beta 5
NCBI Official Symbol
GNB5
NCBI Official Synonym Symbols
GB5; IDDCA; LADCI
UniProt Protein Name
Guanine nucleotide-binding protein subunit beta-5
UniProt Synonym Protein Names
Gbeta5; Transducin beta chain 5
Protein Family
Guanine nucleotide-binding protein
UniProt Gene Name
GNB5
UniProt Entry Name
GBB5_HUMAN
NCBI Protein Information
guanine nucleotide-binding protein subunit beta-5

NCBI Summary for GNB5

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for GNB5

G-beta 5: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Belongs to the WD repeat G protein beta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, heterotrimeric beta

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: plasma membrane; nucleus

Molecular Function: GTPase activity; G-protein gamma-subunit binding; protein binding; signal transducer activity; chaperone binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; metabolic process; signal transduction
Show more

Research Articles on GNB5

1. individuals with loss-of-function GNB5 alleles had more severe symptoms, including substantial developmental delay, speech defects, severe hypotonia, pathological gastro-esophageal reflux, retinal disease, and sinus-node dysfunction, whereas related heterozygotes harboring missense variants presented with a clinically milder phenotype
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GNB5 antibody

 Reference Product  PubMed Publications
 RGS7 antibody  >33 publications with GNB5 and RGS7
 RGS9 antibody  >25 publications with GNB5 and RGS9
 RGS11 antibody  >9 publications with GNB5 and RGS11
 GNG2 antibody  >2 publications with GNB5 and GNG2
 RGS9BP antibody  >1 publications with GNB5 and RGS9BP

Pathways associated with anti-GNB5 antibody

 Products by Pathway  Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 1 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 1 Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 12 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 12 Pathway Diagram
 Activation Of Kainate Receptors Upon Glutamate Binding Pathway antibodies  Activation Of Kainate Receptors Upon Glutamate Binding Pathway Diagram
 Adrenaline,noradrenaline Inhibits Insulin Secretion Pathway antibodies  Adrenaline,noradrenaline Inhibits Insulin Secretion Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Aquaporin-mediated Transport Pathway antibodies  Aquaporin-mediated Transport Pathway Diagram
 Beta-catenin Independent WNT Signaling Pathway antibodies  Beta-catenin Independent WNT Signaling Pathway Diagram
 Ca2+ Pathway antibodies  Ca2+ Pathway Diagram
 Calcium Regulation In The Cardiac Cell Pathway antibodies  Calcium Regulation In The Cardiac Cell Pathway Diagram

Diseases associated with anti-GNB5 antibody

 Disease Name  Pubmed Publications
 Brain Diseases Antibodies  >9 publications with GNB5 and Brain Diseases
 Kidney Diseases Antibodies  >5 publications with GNB5 and Kidney Diseases
 Cardiovascular Diseases Antibodies  >1 publications with GNB5 and Cardiovascular Diseases
 Neoplasm Metastasis Antibodies  >1 publications with GNB5 and Neoplasm Metastasis
 Liver Diseases Antibodies  >1 publications with GNB5 and Liver Diseases
 Hypertension Antibodies  >1 publications with GNB5 and Hypertension
 Neurobehavioral Manifestations Antibodies  >1 publications with GNB5 and Neurobehavioral Manifestations
 Abnormalities, Multiple Antibodies  >1 publications with GNB5 and Abnormalities, Multiple
 Learning Disorders Antibodies  >1 publications with GNB5 and Learning Disorders
 Necrosis Antibodies  >1 publications with GNB5 and Necrosis

Organs/Tissues associated with anti-GNB5 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >35 publications with GNB5 and Brain
 Eye Antibodies  >19 publications with GNB5 and Eye
 Kidney Antibodies  >9 publications with GNB5 and Kidney
 Nerve Antibodies  >6 publications with GNB5 and Nerve
 Pituitary Gland Antibodies  >2 publications with GNB5 and Pituitary Gland
 Lung Antibodies  >2 publications with GNB5 and Lung
 Ganglia Antibodies  >2 publications with GNB5 and Ganglia
 Blood Antibodies  >2 publications with GNB5 and Blood
 Spleen Antibodies  >1 publications with GNB5 and Spleen
 Liver Antibodies  >1 publications with GNB5 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000