• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GNG11 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147421

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GNG11, Monoclonal Antibody
Full Product Name
GNG11 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-11, GNGT11) (FITC)
Product Gene Name
anti-GNG11 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GNG11.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
8,481 Da
OMIM
604390
3D Structure
ModBase 3D Structure for P61952
Immunogen
Partial recombinant corresponding to aa1-69 from human GNG11 (NP_004117.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS
Conjugate
FITC

Product Categories/Family for anti-GNG11 antibody

Antibodies; G Proteins
Applications Tested/Suitable for anti-GNG11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GNG11 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GNG11 antibody

Western Blot detection against Immunogen (33.33kD).
Mouse Anti-GNG11 Monoclonal Antibody – Cat# MBS6147421

Testing Data of anti-GNG11 antibody

Detection limit for recombinant GST tagged GNG11 is ~3ng/ml as a capture antibody.
Mouse Anti-GNG11 Monoclonal Antibody, Testing Data – Cat# MBS6147421

Testing Data of anti-GNG11 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between SMURF1 and GNG11. HeLa cells were stained with SMURF1 rabbit purified polyclonal 1:1200 and GNG11 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-GNG11 Monoclonal Antibody, Testing Data – Cat# MBS6147421

Other Notes

Small volumes of anti-GNG11 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GNG11 purchase

MBS6147421 is an antibody targeting GNG11. Also known as GNG11 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-11, GNGT11) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GNG11. It may not necessarily be applicable to this product.

NCBI GI #
4758448
NCBI GeneID
2791
NCBI Accession #
NP_004117.1
UniProt Primary Accession #
P61952
UniProt Secondary Accession #
P50152
UniProt Related Accession #
P61952
GenBank Nucleotide #
NM_004126
NCBI Official Full Name
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
NCBI Official Synonym Full Names
guanine nucleotide binding protein (G protein), gamma 11
NCBI Official Symbol
GNG11
NCBI Official Synonym Symbols
GNGT11
UniProt Protein Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
UniProt Gene Name
GNG11
UniProt Synonym Gene Names
GNGT11
UniProt Entry Name
GBG11_HUMAN
NCBI Protein Information
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; G protein gamma-11 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit

NCBI Summary for GNG11

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for GNG11

G-gamma 11: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Belongs to the G protein gamma family.

Protein type: G protein, heterotrimeric gamma

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: plasma membrane; heterotrimeric G-protein complex

Molecular Function: GTPase activity; signal transducer activity

Biological Process: G-protein coupled receptor protein signaling pathway; energy reserve metabolic process; signal transduction
Show more

Research Articles on GNG11

1. Collectively, these results suggest a novel senescence pathway mediated by GNG11 in response to environmental cues.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GNG11 antibody

 Reference Product  PubMed Publications
 GNG12 antibody  >1 publications with GNG11 and GNG12
 ADCY8 antibody  >1 publications with GNG11 and ADCY8
 ADCY9 antibody  >1 publications with GNG11 and ADCY9

Pathways associated with anti-GNG11 antibody

 Products by Pathway  Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 1 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 1 Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 12 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 12 Pathway Diagram
 Activation Of Kainate Receptors Upon Glutamate Binding Pathway antibodies  Activation Of Kainate Receptors Upon Glutamate Binding Pathway Diagram
 Adrenaline,noradrenaline Inhibits Insulin Secretion Pathway antibodies  Adrenaline,noradrenaline Inhibits Insulin Secretion Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Aquaporin-mediated Transport Pathway antibodies  Aquaporin-mediated Transport Pathway Diagram
 Ca2+ Pathway antibodies  Ca2+ Pathway Diagram
 Calcium Regulation In The Cardiac Cell Pathway antibodies  Calcium Regulation In The Cardiac Cell Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram

Diseases associated with anti-GNG11 antibody

 Disease Name  Pubmed Publications
 Necrosis Antibodies  >2 publications with GNG11 and Necrosis
 Kidney Diseases Antibodies  >1 publications with GNG11 and Kidney Diseases
 Inflammation Antibodies  >1 publications with GNG11 and Inflammation

Organs/Tissues associated with anti-GNG11 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >4 publications with GNG11 and Blood
 Eye Antibodies  >2 publications with GNG11 and Eye
 Muscle Antibodies  >2 publications with GNG11 and Muscle
 Adipose Tissue Antibodies  >1 publications with GNG11 and Adipose Tissue
 Lung Antibodies  >1 publications with GNG11 and Lung
 Kidney Antibodies  >1 publications with GNG11 and Kidney
 Liver Antibodies  >1 publications with GNG11 and Liver
 Spleen Antibodies  >1 publications with GNG11 and Spleen
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000