• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HHIP Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147575

MBS6147575 is an antibody targeting HHIP. Also known as HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HHIP, Monoclonal Antibody
Full Product Name
HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (FITC)
Product Gene Name
anti-HHIP antibody
Product Synonym Names
HHIP
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5D11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human HHIP.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
36,373 Da
OMIM
606178
3D Structure
ModBase 3D Structure for Q96QV1
Immunogen
Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Conjugate
FITC

Product Categories/Family for anti-HHIP antibody

Antibodies; Sonic Hedgehog (SHH)
Applications Tested/Suitable for anti-HHIP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-HHIP antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-HHIP antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-HHIP Monoclonal Antibody – Cat# MBS6147575

Western Blot (WB) of anti-HHIP antibody

Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.
Mouse Anti-HHIP Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147575

Immunohistochemistry (IHC) of anti-HHIP antibody

Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].
Mouse Anti-HHIP Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6147575

Immunoprecipitation (IP) of anti-HHIP antibody

Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.
Mouse Anti-HHIP Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6147575

Testing Data of anti-HHIP antibody

Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.
Mouse Anti-HHIP Monoclonal Antibody, Testing Data – Cat# MBS6147575

Western Blot (WB) of anti-HHIP antibody

HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.
Mouse Anti-HHIP Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147575

Western Blot (WB) of anti-HHIP antibody

HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.
Mouse Anti-HHIP Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147575

Other Notes

Small volumes of anti-HHIP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HHIP. It may not necessarily be applicable to this product.

NCBI GI #
20143973
NCBI GeneID
64399
NCBI Accession #
NP_071920
UniProt Primary Accession #
Q96QV1
UniProt Secondary Accession #
Q6PK09; Q8NCI7; Q9BXK3; Q9H1J4; Q9H7E7
UniProt Related Accession #
Q96QV1
GenBank Nucleotide #
NM_022475
NCBI Official Full Name
hedgehog-interacting protein
NCBI Official Synonym Full Names
hedgehog interacting protein
NCBI Official Symbol
HHIP
NCBI Official Synonym Symbols
HIP
UniProt Protein Name
Hedgehog-interacting protein
Protein Family
Hedgehog-interacting protein
UniProt Gene Name
HHIP
UniProt Synonym Gene Names
HIP; HHIP; HIP
UniProt Entry Name
HHIP_HUMAN
NCBI Protein Information
hedgehog-interacting protein

UniProt Comments for HHIP

HHIP: Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family. Belongs to the HHIP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q28-q32

Cellular Component: cell surface; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function: protein binding; oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor; zinc ion binding; quinone binding

Biological Process: smoothened signaling pathway; dorsal/ventral pattern formation; skeletal morphogenesis; negative regulation of smoothened signaling pathway; neuroblast proliferation; carbohydrate metabolic process; regulation of fibroblast growth factor receptor signaling pathway; negative regulation of signal transduction
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HHIP antibody

 Reference Product  PubMed Publications
 SHH antibody  >35 publications with HHIP and SHH
 GLI1 antibody  >23 publications with HHIP and GLI1
 PTCH1 antibody  >19 publications with HHIP and PTCH1
 SMO antibody  >17 publications with HHIP and SMO
 IHH antibody  >16 publications with HHIP and IHH
 GLI2 antibody  >8 publications with HHIP and GLI2
 FAM13A antibody  >8 publications with HHIP and FAM13A
 DHH antibody  >7 publications with HHIP and DHH

Pathways associated with anti-HHIP antibody

 Products by Pathway  Pathway Diagram
 Basal Cell Carcinoma Pathway antibodies  Basal Cell Carcinoma Pathway Diagram
 Basal Cell Carcinoma Pathway antibodies  Basal Cell Carcinoma Pathway Diagram
 Hedgehog 'on' State Pathway antibodies  Hedgehog 'on' State Pathway Diagram
 Hedgehog Signaling Pathway antibodies  Hedgehog Signaling Pathway Diagram
 Hedgehog Signaling Pathway antibodies  Hedgehog Signaling Pathway Diagram
 Hedgehog Signaling Pathway antibodies  Hedgehog Signaling Pathway Diagram
 Ligand-receptor Interactions Pathway antibodies  Ligand-receptor Interactions Pathway Diagram
 Pathways In Cancer antibodies  Pathways In Cancer Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By Hedgehog Pathway antibodies  Signaling By Hedgehog Pathway Diagram

Diseases associated with anti-HHIP antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >33 publications with HHIP and Neoplasms
 Adenocarcinoma Antibodies  >9 publications with HHIP and Adenocarcinoma
 Pancreatic Neoplasms Antibodies  >8 publications with HHIP and Pancreatic Neoplasms
 Liver Diseases Antibodies  >6 publications with HHIP and Liver Diseases
 Liver Neoplasms Antibodies  >5 publications with HHIP and Liver Neoplasms
 Carcinoma, Hepatocellular Antibodies  >4 publications with HHIP and Carcinoma, Hepatocellular
 Neoplasms, Experimental Antibodies  >3 publications with HHIP and Neoplasms, Experimental
 Inflammation Antibodies  >3 publications with HHIP and Inflammation
 Nervous System Malformations Antibodies  >2 publications with HHIP and Nervous System Malformations
 Disease Models, Animal Antibodies  >2 publications with HHIP and Disease Models, Animal

Organs/Tissues associated with anti-HHIP antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >23 publications with HHIP and Lung
 Brain Antibodies  >9 publications with HHIP and Brain
 Vascular Antibodies  >6 publications with HHIP and Vascular
 Muscle Antibodies  >5 publications with HHIP and Muscle
 Intestine Antibodies  >4 publications with HHIP and Intestine
 Prostate Antibodies  >4 publications with HHIP and Prostate
 Ovary Antibodies  >3 publications with HHIP and Ovary
 Testis Antibodies  >3 publications with HHIP and Testis
 Eye Antibodies  >2 publications with HHIP and Eye
 Uterus Antibodies  >2 publications with HHIP and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000