Mouse Anti-HINT2 Monoclonal Antibody – Cat# MBS6147581

Western Blot detection against Immunogen (37.55kD).

HINT2 Antibody – Mouse Monoclonal

Name: HINT2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6147581
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147581

Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]). [supplied by OMIM]. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HINT2, Monoclonal Antibody

Full Product Name

HINT2 (Histidine Triad Nucleotide-binding Protein 2, Mitochondrial, HINT-3, HIT-17kDa, PKCI-1-related HIT Protein) (FITC)

Product Gene Name

anti-HINT2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4E11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human HINT2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

17,162 Da

OMIM

609997

3D Structure

ModBase 3D Structure for Q9BX68

Immunogen

Partial recombinant corresponding to aa60-164 from human HINT2 (NP_115982) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG

Conjugate

FITC

Product Categories/Family for anti-HINT2 antibody

Antibodies; Binding Proteins

Applications Tested/Suitable for anti-HINT2 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-HINT2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HINT2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HINT2 purchase

MBS6147581 is an antibody targeting HINT2. Also known as HINT2 (Histidine Triad Nucleotide-binding Protein 2, Mitochondrial, HINT-3, HIT-17kDa, PKCI-1-related HIT Protein) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HINT2. It may not necessarily be applicable to this product.

NCBI GI #

14211923

NCBI GeneID

84681

NCBI Accession #

NP_115982

UniProt Primary Accession #

Q9BX68

UniProt Secondary Accession #

Q5TCW3

UniProt Related Accession #

Q9BX68

GenBank Nucleotide #

NM_032593

NCBI Official Full Name

histidine triad nucleotide-binding protein 2, mitochondrial

NCBI Official Synonym Full Names

histidine triad nucleotide binding protein 2

NCBI Official Symbol

HINT2

NCBI Official Synonym Symbols

HIT-17

UniProt Protein Name

Histidine triad nucleotide-binding protein 2, mitochondrial

UniProt Synonym Protein Names

HINT-3; HIT-17kDa; PKCI-1-related HIT protein

Protein Family

Histidine triad nucleotide-binding protein

UniProt Gene Name

HINT2

UniProt Synonym Gene Names

HINT-2

UniProt Entry Name

HINT2_HUMAN

NCBI Protein Information

histidine triad nucleotide-binding protein 2, mitochondrial

NCBI Summary for HINT2

Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008]

UniProt Comments for HINT2

HINT2: Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity. Belongs to the HINT family.

Protein type: EC 3.-.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: mitochondrion; nucleolus

Molecular Function: hydrolase activity; nucleotide binding

Biological Process: apoptosis; steroid biosynthetic process

Research Articles on HINT2

1. Authors deduced that HINT2 triggers apoptosis in pancreatic cancer cells by regulating mitochondrial Ca(2+) influx through the mitochondrial calcium uniporter (MCU). Authors found that HINT2 can sensitize BxPC-3 and L3.6pl cells to gemcitabine-induced apoptosis and that gemcitabine up-regulates HINT2 expression.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-HINT2 antibody

Disease Name	Pubmed Publications
Carcinoma, Hepatocellular Antibodies	>2 publications with HINT2 and Carcinoma, Hepatocellular
Liver Neoplasms Antibodies	>1 publications with HINT2 and Liver Neoplasms
Disease Models, Animal Antibodies	>1 publications with HINT2 and Disease Models, Animal
Adenocarcinoma Antibodies	>1 publications with HINT2 and Adenocarcinoma
Fatty Liver Antibodies	>1 publications with HINT2 and Fatty Liver

Organs/Tissues associated with anti-HINT2 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>5 publications with HINT2 and Liver
Pancreas Antibodies	>3 publications with HINT2 and Pancreas
Blood Antibodies	>2 publications with HINT2 and Blood
Adrenal Gland Antibodies	>1 publications with HINT2 and Adrenal Gland
Uterus Antibodies	>1 publications with HINT2 and Uterus
Kidney Antibodies	>1 publications with HINT2 and Kidney
Embryonic Tissue Antibodies	>1 publications with HINT2 and Embryonic Tissue