• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ID1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147703

MBS6147703 is an antibody targeting ID1. Also known as ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ID1, Monoclonal Antibody
Full Product Name
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (FITC)
Product Gene Name
anti-ID1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ID1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
15,586 Da
Immunogen
Full length recombinant corresponding to aa1-155 from human ID1 (AAH00613.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Conjugate
FITC

Product Categories/Family for anti-ID1 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-ID1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-ID1 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ID1 antibody

Western Blot detection against Immunogen (42.79kD).
Mouse Anti-ID1 Monoclonal Antibody – Cat# MBS6147703

Western Blot (WB) of anti-ID1 antibody

Western Blot analysis of ID1 expression in transfected 293T cell line by ID1 monoclonal antibody. Lane 1: ID1 transfected lysate (16.1kD). Lane 2: Non-transfected lysate.
Mouse Anti-ID1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147703

Immunofluorescence (IF) of anti-ID1 antibody

Immunofluorescence of monoclonal antibody to ID1 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-ID1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6147703

Testing Data of anti-ID1 antibody

Detection limit for recombinant GST tagged ID1 is ~0.1ng/ml as a capture antibody.
Mouse Anti-ID1 Monoclonal Antibody, Testing Data – Cat# MBS6147703

Western Blot (WB) of anti-ID1 antibody

Western blot analysis of ID1 over-expressed 293 cell line, cotransfected with ID1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ID1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-ID1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147703

Other Notes

Small volumes of anti-ID1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ID1. It may not necessarily be applicable to this product.

NCBI GI #
33875639
NCBI GeneID
3397
NCBI Accession #
BC000613
NCBI Related Accession #
AAH00613.1
UniProt Secondary Accession #
O00651; O00652; Q16371; Q16377; Q5TE66; Q5TE67; Q969Z7; Q9H0Z5; Q9H109; A8K537; E1P5L4
UniProt Related Accession #
P41134
NCBI Official Full Name
Homo sapiens inhibitor of DNA binding 1, dominant negative helix-loop-helix protein, mRNA
NCBI Official Synonym Full Names
inhibitor of DNA binding 1, HLH protein
NCBI Official Symbol
ID1
NCBI Official Synonym Symbols
ID; bHLHb24
Protein Family
DNA-binding protein inhibitor
NCBI Protein Information
DNA-binding protein inhibitor ID-1

NCBI Summary for ID1

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Show more

Research Articles on ID1

1. Id-1, a protein repressed by miR-29b, facilitates TGFbeta1-induced EMT in human ovarian cancer cells and represents a promising therapeutic target for treating ovarian cancer.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ID1 antibody

 Products by Pathway  Pathway Diagram
 ALK1 Signaling Events Pathway antibodies  ALK1 Signaling Events Pathway Diagram
 Hippo Signaling Pathway antibodies  Hippo Signaling Pathway Diagram
 Hippo Signaling Pathway antibodies  Hippo Signaling Pathway Diagram
 IL-3 Signaling Pathway antibodies  IL-3 Signaling Pathway Diagram
 Id Signaling Pathway antibodies  Id Signaling Pathway Diagram
 Neural Crest Differentiation Pathway antibodies  Neural Crest Differentiation Pathway Diagram
 Notch-mediated HES/HEY Network Pathway antibodies  Notch-mediated HES/HEY Network Pathway Diagram
 TGF-beta Signaling Pathway antibodies  TGF-beta Signaling Pathway Diagram
 TGF-beta Signaling Pathway antibodies  TGF-beta Signaling Pathway Diagram

Diseases associated with anti-ID1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >311 publications with ID1 and Neoplasms
 Carcinoma Antibodies  >110 publications with ID1 and Carcinoma
 Breast Neoplasms Antibodies  >55 publications with ID1 and Breast Neoplasms
 Adenocarcinoma Antibodies  >44 publications with ID1 and Adenocarcinoma
 Cell Transformation, Neoplastic Antibodies  >37 publications with ID1 and Cell Transformation, Neoplastic
 Neoplasms, Experimental Antibodies  >31 publications with ID1 and Neoplasms, Experimental
 Lung Neoplasms Antibodies  >25 publications with ID1 and Lung Neoplasms
 Necrosis Antibodies  >21 publications with ID1 and Necrosis
 Cardiovascular Diseases Antibodies  >19 publications with ID1 and Cardiovascular Diseases
 Liver Diseases Antibodies  >17 publications with ID1 and Liver Diseases

Organs/Tissues associated with anti-ID1 antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >217 publications with ID1 and Bone
 Blood Antibodies  >141 publications with ID1 and Blood
 Vascular Antibodies  >99 publications with ID1 and Vascular
 Muscle Antibodies  >92 publications with ID1 and Muscle
 Brain Antibodies  >63 publications with ID1 and Brain
 Lung Antibodies  >58 publications with ID1 and Lung
 Prostate Antibodies  >57 publications with ID1 and Prostate
 Liver Antibodies  >55 publications with ID1 and Liver
 Embryonic Tissue Antibodies  >55 publications with ID1 and Embryonic Tissue
 Skin Antibodies  >32 publications with ID1 and Skin
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000