Mouse Anti-IFIT3 Monoclonal Antibody – Cat# MBS6147717

Detection limit for recombinant GST tagged IFIT3 is 0.03ng/ml as a capture antibody.

IFIT3 Antibody – Mouse Monoclonal

Name: IFIT3 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6147717
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147717

MBS6147717 is an antibody targeting IFIT3. Also known as IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4,… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

IFIT3, Monoclonal Antibody

Full Product Name

IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG

Product Gene Name

anti-IFIT3 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2C10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human IFIT3.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

53 kDa

OMIM

604650

3D Structure

ModBase 3D Structure for O14879

Immunogen

Partial recombinant corresponding to aa392-490 from human IFIT3 (NP_001540.2) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

STDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN

Conjugate

FITC

Product Categories/Family for anti-IFIT3 antibody

Antibodies; Interferon

Applications Tested/Suitable for anti-IFIT3 antibody

ELISA (EIA)

Application Notes for anti-IFIT3 antibody

Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-IFIT3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for IFIT3. It may not necessarily be applicable to this product.

NCBI GI #

31542980

NCBI GeneID

3437

NCBI Accession #

NP_001540.2

UniProt Primary Accession #

O14879

UniProt Related Accession #

O14879

GenBank Nucleotide #

NM_001549

NCBI Official Full Name

interferon-induced protein with tetratricopeptide repeats 3 isoform a

NCBI Official Synonym Full Names

interferon induced protein with tetratricopeptide repeats 3

NCBI Official Symbol

IFIT3

NCBI Official Synonym Symbols

P60; IRG2; IFI60; IFIT4; ISG60; RIG-G; cig41; CIG-49; GARG-49

UniProt Protein Name

Interferon-induced protein with tetratricopeptide repeats 3

UniProt Synonym Protein Names

CIG49; ISG-60; Interferon-induced 60 kDa protein; IFI-60K; Interferon-induced protein with tetratricopeptide repeats 4; IFIT-4; Retinoic acid-induced gene G protein; P60; RIG-G

Protein Family

Interferon-induced protein with tetratricopeptide repeats

UniProt Gene Name

IFIT3

UniProt Synonym Gene Names

CIG-49; IFI60; IFIT4; ISG60; IFIT-3; IFI-60K; IFIT-4; P60; RIG-G

UniProt Entry Name

IFIT3_HUMAN

NCBI Protein Information

interferon-induced protein with tetratricopeptide repeats 3

UniProt Comments for IFIT3

IFIT3: IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS- mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin- dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2. Belongs to the IFIT family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: negative regulation of cell proliferation; cytokine and chemokine mediated signaling pathway; response to virus; defense response to virus; negative regulation of apoptosis

Research Articles on IFIT3

1. We provided the evidence that IFIT3 was up-regulated during hepatic ischemia-reperfusion injury (IRI) and knockdown of IFIT3 exerted potent protective effects against hepatic IRI in vitro and in vivo. Our findings not only revealed the mechanism for IFIT3-regulated hepatic IRI, but also proposed potential clinical significance of treatment targeting IFIT3 for patients undergoing liver resection and liver transplantation.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IFIT3 antibody

Reference Product	PubMed Publications
IFIT1 antibody	>28 publications with IFIT3 and IFIT1
IFIT2 antibody	>24 publications with IFIT3 and IFIT2
MX1 antibody	>13 publications with IFIT3 and MX1
IRF7 antibody	>8 publications with IFIT3 and IRF7
ISG15 antibody	>7 publications with IFIT3 and ISG15
IFI6 antibody	>3 publications with IFIT3 and IFI6
OAS1 antibody	>3 publications with IFIT3 and OAS1
OASL antibody	>2 publications with IFIT3 and OASL
XAF1 antibody	>1 publications with IFIT3 and XAF1

Pathways associated with anti-IFIT3 antibody

Products by Pathway	Pathway Diagram
Cytokine Signaling In Immune System Pathway antibodies	Cytokine Signaling In Immune System Pathway Diagram
Immune System Pathway antibodies	Immune System Pathway Diagram
Interferon Signaling Pathway antibodies	Interferon Signaling Pathway Diagram
Interferon Alpha/beta Signaling Pathway antibodies	Interferon Alpha/beta Signaling Pathway Diagram

Diseases associated with anti-IFIT3 antibody

Disease Name	Pubmed Publications
Nervous System Diseases Antibodies	>8 publications with IFIT3 and Nervous System Diseases
Inflammation Antibodies	>5 publications with IFIT3 and Inflammation
Necrosis Antibodies	>3 publications with IFIT3 and Necrosis
Liver Diseases Antibodies	>2 publications with IFIT3 and Liver Diseases
Carcinoma Antibodies	>1 publications with IFIT3 and Carcinoma
Atherosclerosis Antibodies	>1 publications with IFIT3 and Atherosclerosis
Fibrosis Antibodies	>1 publications with IFIT3 and Fibrosis
Cardiovascular Diseases Antibodies	>1 publications with IFIT3 and Cardiovascular Diseases
Neoplasms, Experimental Antibodies	>1 publications with IFIT3 and Neoplasms, Experimental
Carcinoma, Hepatocellular Antibodies	>1 publications with IFIT3 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-IFIT3 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>16 publications with IFIT3 and Blood
Brain Antibodies	>6 publications with IFIT3 and Brain
Lung Antibodies	>4 publications with IFIT3 and Lung
Muscle Antibodies	>2 publications with IFIT3 and Muscle
Lymph Node Antibodies	>1 publications with IFIT3 and Lymph Node
Intestine Antibodies	>1 publications with IFIT3 and Intestine
Vascular Antibodies	>1 publications with IFIT3 and Vascular
Mouth Antibodies	>1 publications with IFIT3 and Mouth