• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAML2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148098

Acts as a transcriptional coactivator for NOTCH proteins. Has been shown to amplify NOTCH-induced transcription of HES1. Potentiates activation by NOTCH3 and NOTCH4 more efficiently than MAML1 or MAML3. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAML2, Monoclonal Antibody
Full Product Name
MAML2 (Mastermind-like Protein 2, Mam-2, KIAA1819, DKFZp686N0150, MGC176701, MLL-MAML2) (FITC)
Product Gene Name
anti-MAML2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MAML2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
607537
3D Structure
ModBase 3D Structure for Q8IZL2
Immunogen
Partial recombinant corresponding to aa796-895 from human MAML2 (NP_115803) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQQR
Conjugate
FITC

Product Categories/Family for anti-MAML2 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-MAML2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-MAML2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MAML2 antibody

Western Blot detection against Immunogen (37kD).
Mouse Anti-MAML2 Monoclonal Antibody – Cat# MBS6148098

Western Blot (WB) of anti-MAML2 antibody

MAML2 monoclonal antibody, Western Blot analysis of MAML2 expression in MCF-7.
Mouse Anti-MAML2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148098

Testing Data of anti-MAML2 antibody

Detection limit for recombinant GST tagged MAML2 is ~1ng/ml as a capture antibody.
Mouse Anti-MAML2 Monoclonal Antibody, Testing Data – Cat# MBS6148098

Other Notes

Small volumes of anti-MAML2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAML2 purchase

MBS6148098 is an antibody targeting MAML2. Also known as MAML2 (Mastermind-like Protein 2, Mam-2, KIAA1819, DKFZp686N0150, MGC176701, MLL-MAML2) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MAML2. It may not necessarily be applicable to this product.

NCBI GI #
33286444
NCBI GeneID
84441
NCBI Accession #
NP_115803
UniProt Primary Accession #
Q8IZL2
UniProt Related Accession #
Q8IZL2
GenBank Nucleotide #
NM_032427
NCBI Official Full Name
mastermind-like protein 2
NCBI Official Synonym Full Names
mastermind like transcriptional coactivator 2
NCBI Official Symbol
MAML2
NCBI Official Synonym Symbols
MAM2; MAM3; MAM-3; MLL-MAML2
UniProt Protein Name
Mastermind-like protein 2
Protein Family
Mastermind-like protein
UniProt Gene Name
MAML2
UniProt Synonym Gene Names
KIAA1819
UniProt Entry Name
MAML2_HUMAN
NCBI Protein Information
mastermind-like protein 2

NCBI Summary for MAML2

The protein encoded by this gene is a member of the Mastermind-like family of proteins. All family members are proline and glutamine-rich, and contain a conserved basic domain that binds the ankyrin repeat domain of the intracellular domain of the Notch receptors (ICN1-4) in their N-terminus, and a transcriptional activation domain in their C-terminus. This protein binds to an extended groove that is formed by the interaction of CBF1, Suppressor of Hairless, LAG-1 (CSL) with ICN, and positively regulates Notch signaling. High levels of expression of this gene have been observed in several B cell-derived lymphomas. Translocations resulting in fusion proteins with both CRTC1 and CRTC3 have been implicated in the development of mucoepidermoid carcinomas, while a translocation event with CXCR4 has been linked with chronic lymphocytic leukemia (CLL). Copy number variation in the polyglutamine tract has been observed. [provided by RefSeq, Jan 2015]
Show more

Research Articles on MAML2

1. The rs7944701 SNP in MAML2 was strongly associated with bladder cancer susceptibility in a Chinese population. MAML2 expression was lower in bladder cancer tissues than in non-tumor tissues and bladder cancer patients with high MAML2 expression had a significantly poorer prognosis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAML2 antibody

 Reference Product  PubMed Publications
 NOTCH1 antibody  >6 publications with MAML2 and NOTCH1
 NOTCH4 antibody  >2 publications with MAML2 and NOTCH4
 NOTCH3 antibody  >1 publications with MAML2 and NOTCH3
 NOTCH2 antibody  >1 publications with MAML2 and NOTCH2

Pathways associated with anti-MAML2 antibody

 Products by Pathway  Pathway Diagram
 Delta-Notch Signaling Pathway antibodies  Delta-Notch Signaling Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Generic Transcription Pathway antibodies  Generic Transcription Pathway Diagram
 Notch Signaling Pathway antibodies  Notch Signaling Pathway Diagram
 Notch Signaling Pathway antibodies  Notch Signaling Pathway Diagram
 Notch Signaling Pathway antibodies  Notch Signaling Pathway Diagram
 Notch-HLH Transcription Pathway antibodies  Notch-HLH Transcription Pathway Diagram
 Notch-mediated HES/HEY Network Pathway antibodies  Notch-mediated HES/HEY Network Pathway Diagram

Diseases associated with anti-MAML2 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >52 publications with MAML2 and Neoplasms
 Carcinoma Antibodies  >45 publications with MAML2 and Carcinoma
 Adenocarcinoma Antibodies  >36 publications with MAML2 and Adenocarcinoma
 Head and Neck Neoplasms Antibodies  >27 publications with MAML2 and Head and Neck Neoplasms
 Mouth Neoplasms Antibodies  >26 publications with MAML2 and Mouth Neoplasms
 Chromosome Aberrations Antibodies  >20 publications with MAML2 and Chromosome Aberrations
 Adenoma Antibodies  >7 publications with MAML2 and Adenoma
 Lung Neoplasms Antibodies  >7 publications with MAML2 and Lung Neoplasms
 Skin Neoplasms Antibodies  >6 publications with MAML2 and Skin Neoplasms
 Lung Diseases Antibodies  >6 publications with MAML2 and Lung Diseases

Organs/Tissues associated with anti-MAML2 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >7 publications with MAML2 and Lung
 Mouth Antibodies  >6 publications with MAML2 and Mouth
 Skin Antibodies  >6 publications with MAML2 and Skin
 Thyroid Antibodies  >3 publications with MAML2 and Thyroid
 Mammary Gland Antibodies  >3 publications with MAML2 and Mammary Gland
 Blood Antibodies  >2 publications with MAML2 and Blood
 Liver Antibodies  >1 publications with MAML2 and Liver
 Prostate Antibodies  >1 publications with MAML2 and Prostate
 Embryonic Tissue Antibodies  >1 publications with MAML2 and Embryonic Tissue
 Kidney Antibodies  >1 publications with MAML2 and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000