Mouse Anti-MAN2A1 Monoclonal Antibody – Cat# MBS6148100

Western Blot detection against Immunogen (36.74kD).

MAN2A1 Antibody – Mouse Monoclonal

Name: MAN2A1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6148100
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148100

This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The protein is located in the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MAN2A1, Monoclonal Antibody

Full Product Name

MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (FITC)

Product Gene Name

anti-MAN2A1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1G9

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human MAN2A1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

154582

3D Structure

ModBase 3D Structure for Q16706

Immunogen

Partial recombinant corresponding to aa1045-1144 from human MAN2A1 (NP_002363) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR

Conjugate

FITC

Product Categories/Family for anti-MAN2A1 antibody

Antibodies; Enzymes; Glycosidase

Applications Tested/Suitable for anti-MAN2A1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-MAN2A1 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-MAN2A1 antibody

1. Quantitative Proteomic Analysis of PCSK9 Gain of Function in Human Hepatic HuH7 Cells. Denis N, Palmer-Smith H, Elisma F, Busuttil A, Wright TG, Khalil MB, Prat A, Seidah NG, Chretien M, Mayne J, Figeys D.J Proteome Res. 2011 Mar 10.

Other Notes

Small volumes of anti-MAN2A1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAN2A1 purchase

MBS6148100 is an antibody targeting MAN2A1. Also known as MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MAN2A1. It may not necessarily be applicable to this product.

NCBI GI #

51477714

NCBI GeneID

4124

NCBI Accession #

NP_002363

UniProt Primary Accession #

Q16706

UniProt Related Accession #

Q16706

GenBank Nucleotide #

NM_002372

NCBI Official Full Name

alpha-mannosidase 2

NCBI Official Synonym Full Names

mannosidase alpha class 2A member 1

NCBI Official Symbol

MAN2A1

NCBI Official Synonym Symbols

MANA2; MANII; GOLIM7; AMan II

UniProt Protein Name

Alpha-mannosidase 2

UniProt Synonym Protein Names

Golgi alpha-mannosidase II; AMan II; Man II; Mannosidase alpha class 2A member 1; Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase

UniProt Gene Name

MAN2A1

UniProt Synonym Gene Names

MANA2; AMan II; Man II

UniProt Entry Name

MA2A1_HUMAN

NCBI Protein Information

alpha-mannosidase 2

NCBI Summary for MAN2A1

This gene encodes a glycosyl hydrolase that localizes to the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus. [provided by RefSeq, Dec 2013]

UniProt Comments for MAN2A1

MAN2A1: Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway. Belongs to the glycosyl hydrolase 38 family.

Protein type: Glycan Metabolism - N-glycan biosynthesis; Membrane protein, integral; EC 3.2.1.114; Hydrolase

Chromosomal Location of Human Ortholog: 5q21.3

Cellular Component: Golgi membrane; cis-Golgi network; membrane; integral to membrane

Molecular Function: hydrolase activity, hydrolyzing N-glycosyl compounds; zinc ion binding; mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity; carbohydrate binding

Biological Process: mannose metabolic process; mitochondrion organization and biogenesis; positive regulation of neurogenesis; cellular protein metabolic process; in utero embryonic development; protein amino acid N-linked glycosylation via asparagine; respiratory gaseous exchange; N-glycan processing; liver development; post-translational protein modification; alveolus development; retina morphogenesis in camera-type eye; vacuole organization and biogenesis

Research Articles on MAN2A1

1. he QSAR models with the fragmented QM-DFT descriptors may find a useful application in structure-based drug design where pure empirical and force field methods reached their limits and where quantum mechanics effects are critical for ligand-receptor interactions. The optimized models will apply in lead optimization processes for GMII drug developments.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAN2A1 antibody

Reference Product	PubMed Publications
MGAT1 antibody	>1 publications with MAN2A1 and MGAT1

Pathways associated with anti-MAN2A1 antibody

Products by Pathway	Pathway Diagram
Asparagine N-linked Glycosylation Pathway antibodies	Asparagine N-linked Glycosylation Pathway Diagram
Defective ALG1 Causes ALG1-CDG (CDG-1k) Pathway antibodies	Defective ALG1 Causes ALG1-CDG (CDG-1k) Pathway Diagram
Defective ALG11 Causes ALG11-CDG (CDG-1p) Pathway antibodies	Defective ALG11 Causes ALG11-CDG (CDG-1p) Pathway Diagram
Defective ALG12 Causes ALG12-CDG (CDG-1g) Pathway antibodies	Defective ALG12 Causes ALG12-CDG (CDG-1g) Pathway Diagram
Defective ALG14 Causes Congenital Myasthenic Syndrome (ALG14-CMS) Pathway antibodies	Defective ALG14 Causes Congenital Myasthenic Syndrome (ALG14-CMS) Pathway Diagram
Defective ALG2 Causes ALG2-CDG (CDG-1i) Pathway antibodies	Defective ALG2 Causes ALG2-CDG (CDG-1i) Pathway Diagram
Defective ALG3 Causes ALG3-CDG (CDG-1d) Pathway antibodies	Defective ALG3 Causes ALG3-CDG (CDG-1d) Pathway Diagram
Defective ALG6 Causes ALG6-CDG (CDG-1c) Pathway antibodies	Defective ALG6 Causes ALG6-CDG (CDG-1c) Pathway Diagram
Defective ALG8 Causes ALG8-CDG (CDG-1h) Pathway antibodies	Defective ALG8 Causes ALG8-CDG (CDG-1h) Pathway Diagram
Defective ALG9 Causes ALG9-CDG (CDG-1l) Pathway antibodies	Defective ALG9 Causes ALG9-CDG (CDG-1l) Pathway Diagram

Diseases associated with anti-MAN2A1 antibody

Disease Name	Pubmed Publications
Anemia Antibodies	>1 publications with MAN2A1 and Anemia
Inflammation Antibodies	>1 publications with MAN2A1 and Inflammation
Poisoning Antibodies	>1 publications with MAN2A1 and Poisoning

Organs/Tissues associated with anti-MAN2A1 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>2 publications with MAN2A1 and Blood
Nerve Antibodies	>1 publications with MAN2A1 and Nerve
Bladder Antibodies	>1 publications with MAN2A1 and Bladder
Prostate Antibodies	>1 publications with MAN2A1 and Prostate
Kidney Antibodies	>1 publications with MAN2A1 and Kidney
Brain Antibodies	>1 publications with MAN2A1 and Brain