• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAP1S Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148105

Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAP1S, Monoclonal Antibody
Full Product Name
MAP1S (BPY2IP1, C19orf5, MAP8, VCY2IP1, Microtubule-associated Protein 1S, BPY2-interacting Protein 1, Microtubule-associated Protein 8, Variable Charge Y Chromosome 2-interacting Protein 1, MAP1S Heavy Chain, MAP1S Light Chain, FLJ10669, MGC133087) (FITC
Product Gene Name
anti-MAP1S antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MAP1S.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
112kDa
OMIM
607573
3D Structure
ModBase 3D Structure for Q66K74
Immunogen
Partial recombinant corresponding to aa929-1027 from human MAP1S (NP_060644) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
Conjugate
FITC

Product Categories/Family for anti-MAP1S antibody

Antibodies; Microtubule-associated Proteins
Applications Tested/Suitable for anti-MAP1S antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-MAP1S antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MAP1S antibody

Western Blot detection against Immunogen (36.89kD).
Mouse Anti-MAP1S Monoclonal Antibody – Cat# MBS6148105

Testing Data of anti-MAP1S antibody

Detection limit for recombinant GST tagged MAP1S is 0.1ng/ml as a capture antibody.
Mouse Anti-MAP1S Monoclonal Antibody, Testing Data – Cat# MBS6148105

Other Notes

Small volumes of anti-MAP1S antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAP1S purchase

MBS6148105 is an antibody targeting MAP1S. Also known as MAP1S (BPY2IP1, C19orf5, MAP8, VCY2IP1, Microtubule-associated Protein 1S, BPY2-interacting Protein 1, Microtubule-associated Protein 8, Variable Charge Y Chromosome 2-interacting Protein 1, MAP1S Heavy Chain, MAP1S Light Chain, FLJ10669, MGC133087) (FITC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MAP1S. It may not necessarily be applicable to this product.

NCBI GI #
50428935
NCBI GeneID
55201
NCBI Accession #
NP_060644
UniProt Primary Accession #
Q66K74
UniProt Related Accession #
Q66K74
GenBank Nucleotide #
NM_018174
NCBI Official Full Name
microtubule-associated protein 1S isoform 1
NCBI Official Synonym Full Names
microtubule associated protein 1S
NCBI Official Symbol
MAP1S
NCBI Official Synonym Symbols
MAP8; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1
UniProt Protein Name
Microtubule-associated protein 1S
UniProt Synonym Protein Names
BPY2-interacting protein 1; Microtubule-associated protein 8; Variable charge Y chromosome 2-interacting protein 1; VCY2-interacting protein 1; VCY2IP-1
Protein Family
Microtubule-associated protein
UniProt Gene Name
MAP1S
UniProt Synonym Gene Names
BPY2IP1; C19orf5; MAP8; VCY2IP1; MAP-1S; VCY2-interacting protein 1; VCY2IP-1
UniProt Entry Name
MAP1S_HUMAN
NCBI Protein Information
microtubule-associated protein 1S

UniProt Comments for MAP1S

BPY2-IP1: Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles. Belongs to the MAP1 family.

Protein type: Microtubule-binding; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: microtubule; cell projection; cell soma; perinuclear region of cytoplasm; cytoplasm; dendrite; nucleolus; spindle; synapse; nucleus; cytosol; cell junction

Molecular Function: tubulin binding; actin filament binding; identical protein binding; protein binding; DNA binding; microtubule binding; deoxyribonuclease activity; beta-tubulin binding

Biological Process: nervous system development; brain development; DNA fragmentation during apoptosis; neurite morphogenesis; microtubule bundle formation; mitochondrion transport along microtubule
Show more

Research Articles on MAP1S

1. Results suggested that microtubule associated protein 1S (MAP1S) were up-regulated among Crohn's disease (CD) patients and MAP1S-related autophagy inhibits apoptosis of intestinal epithelial cells (IECs) through Wnt/beta-catenin signaling pathway which might play a vital role in the protection of intestinal mucosal barrier and inhibition the progression of CD.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-MAP1S antibody

 Disease Name  Pubmed Publications
 Breast Neoplasms Antibodies  >2 publications with MAP1S and Breast Neoplasms
 Cell Transformation, Neoplastic Antibodies  >2 publications with MAP1S and Cell Transformation, Neoplastic
 Lymphoma Antibodies  >1 publications with MAP1S and Lymphoma
 Stomach Neoplasms Antibodies  >1 publications with MAP1S and Stomach Neoplasms
 Immune System Diseases Antibodies  >1 publications with MAP1S and Immune System Diseases
 Aneuploidy Antibodies  >1 publications with MAP1S and Aneuploidy
 Hyperplasia Antibodies  >1 publications with MAP1S and Hyperplasia
 Liver Neoplasms Antibodies  >1 publications with MAP1S and Liver Neoplasms
 Liver Diseases Antibodies  >1 publications with MAP1S and Liver Diseases

Organs/Tissues associated with anti-MAP1S antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >5 publications with MAP1S and Nerve
 Brain Antibodies  >5 publications with MAP1S and Brain
 Prostate Antibodies  >2 publications with MAP1S and Prostate
 Liver Antibodies  >2 publications with MAP1S and Liver
 Bone Antibodies  >1 publications with MAP1S and Bone
 Muscle Antibodies  >1 publications with MAP1S and Muscle
 Eye Antibodies  >1 publications with MAP1S and Eye
 Uterus Antibodies  >1 publications with MAP1S and Uterus
 Embryonic Tissue Antibodies  >1 publications with MAP1S and Embryonic Tissue
 Lung Antibodies  >1 publications with MAP1S and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000