• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAP2K6 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148108

MBS6148108 is an antibody targeting MAP2K6. Also known as MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAP2K6, Monoclonal Antibody
Full Product Name
MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK Kinase 3, SAPKK3, SAPKK-3, SKK3) (FITC)
Product Gene Name
anti-MAP2K6 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MAP2K6.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
31,339 Da
Immunogen
Partial recombinant corresponding to aa231-335, from human MAP2K6 (AAH12009) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Conjugate
FITC

Product Categories/Family for anti-MAP2K6 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-MAP2K6 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-MAP2K6 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MAP2K6 antibody

MAP2K6 monoclonal antibody Western Blot analysis of MAP2K6 expression in COLO 320 HSR.
Mouse Anti-MAP2K6 Monoclonal Antibody – Cat# MBS6148108

Immunofluorescence (IF) of anti-MAP2K6 antibody

Immunofluorescence of monoclonal antibody to MAP2K6 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-MAP2K6 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6148108

Testing Data of anti-MAP2K6 antibody

Detection limit for recombinant GST tagged MAP2K6 is ~0.3ng/ml as a capture antibody.
Mouse Anti-MAP2K6 Monoclonal Antibody, Testing Data – Cat# MBS6148108

Testing Data of anti-MAP2K6 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K3 and MAP2K6 HeLa cells were stained with MAP2K3 rabbit purified polyclonal 1:1200 and MAP2K6 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-MAP2K6 Monoclonal Antibody, Testing Data – Cat# MBS6148108

Other Notes

Small volumes of anti-MAP2K6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for MAP2K6. It may not necessarily be applicable to this product.

NCBI GI #
15080539
NCBI GeneID
5608
NCBI Accession #
BC012009
NCBI Related Accession #
AAH12009
UniProt Related Accession #
P52564
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase kinase 6, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 6
NCBI Official Symbol
MAP2K6
NCBI Official Synonym Symbols
MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; SAPKK-3
Protein Family
Dual specificity mitogen-activated protein kinase kinase
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 6

NCBI Summary for MAP2K6

This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008]
Show more

Research Articles on MAP2K6

1. Data indicate that mitogen-activated protein kinase kinase 6 (MKK6) levels were substantially higher in monocytes than in neutrophils.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MAP2K6 antibody

 Products by Pathway  Pathway Diagram
 Activated TLR4 Signalling Pathway antibodies  Activated TLR4 Signalling Pathway Diagram
 Amyotrophic Lateral Sclerosis (ALS) Pathway antibodies  Amyotrophic Lateral Sclerosis (ALS) Pathway Diagram
 Amyotrophic Lateral Sclerosis (ALS) Pathway antibodies  Amyotrophic Lateral Sclerosis (ALS) Pathway Diagram
 CDC42 Signaling Events Pathway antibodies  CDC42 Signaling Events Pathway Diagram
 CDO In Myogenesis Pathway antibodies  CDO In Myogenesis Pathway Diagram
 CXCR3-mediated Signaling Events Pathway antibodies  CXCR3-mediated Signaling Events Pathway Diagram
 Cellular Roles Of Anthrax Toxin Pathway antibodies  Cellular Roles Of Anthrax Toxin Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Epstein-Barr Virus Infection Pathway antibodies  Epstein-Barr Virus Infection Pathway Diagram

Diseases associated with anti-MAP2K6 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >49 publications with MAP2K6 and Neoplasms
 Necrosis Antibodies  >34 publications with MAP2K6 and Necrosis
 Inflammation Antibodies  >16 publications with MAP2K6 and Inflammation
 Adenocarcinoma Antibodies  >9 publications with MAP2K6 and Adenocarcinoma
 Nervous System Diseases Antibodies  >9 publications with MAP2K6 and Nervous System Diseases
 Cardiovascular Diseases Antibodies  >8 publications with MAP2K6 and Cardiovascular Diseases
 Breast Neoplasms Antibodies  >8 publications with MAP2K6 and Breast Neoplasms
 Brain Diseases Antibodies  >7 publications with MAP2K6 and Brain Diseases
 Liver Diseases Antibodies  >7 publications with MAP2K6 and Liver Diseases
 Neoplasms, Experimental Antibodies  >6 publications with MAP2K6 and Neoplasms, Experimental
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000