Mouse Anti-MTSP1 Monoclonal Antibody – Cat# MBS6148147

Detection limit for recombinant GST tagged ST14 is ~1ng/ml as a capture antibody.

Matriptase (MTSP1) Antibody – Mouse Monoclonal

Name: MTSP1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6148147
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148147

Matriptase or MT-SP1 is an epithelial-derived type II transmembrane serine protease that is highly expressd in human cancer-derived cell lines. Matriptase cleaves and activates protease activated receptor-2, pro-urokinase plasminogen activator and… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Matriptase (MTSP1), Monoclonal Antibody

Full Product Name

Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, MT-SP1, MTSP1, PRSS14) (F

Product Gene Name

anti-MTSP1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2F4

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ST14.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

94,770 Da

OMIM

606797

3D Structure

ModBase 3D Structure for Q9Y5Y6

Immunogen

Partial recombinant corresponding to aa298-401 from human ST14 (NP_068813) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD*

Conjugate

FITC

Product Categories/Family for anti-MTSP1 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

Applications Tested/Suitable for anti-MTSP1 antibody

ELISA (EIA)

Application Notes for anti-MTSP1 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-MTSP1 antibody

1. Novel surface targets and serum biomarkers from the ovarian cancer vasculature. Sasaroli D, Gimotty PA, Pathak HB, Hammond R, Kougioumtzidou E, Katsaros D, Buckanovich R, Devarajan K, Sandaltzopoulos R, Godwin AK, Scholler N, Coukos G.Cancer Biol Ther. 2011 Aug 1;12(3):169-80. Epub 2011 Aug 1.

Other Notes

Small volumes of anti-MTSP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MTSP1 purchase

MBS6148147 is an antibody targeting MTSP1. Also known as Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, MT-SP1, MTSP1, PRSS14) (F. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MTSP1. It may not necessarily be applicable to this product.

NCBI GI #

11415040

NCBI GeneID

6768

NCBI Accession #

NP_068813

UniProt Primary Accession #

Q9Y5Y6

UniProt Secondary Accession #

Q9BS01; Q9H3S0; Q9HB36; Q9HCA3

UniProt Related Accession #

Q9Y5Y6

GenBank Nucleotide #

NM_021978

NCBI Official Full Name

suppressor of tumorigenicity 14 protein

NCBI Official Synonym Full Names

suppression of tumorigenicity 14 (colon carcinoma)

NCBI Official Symbol

ST14

NCBI Official Synonym Symbols

HAI; MTSP1; SNC19; ARCI11; MT-SP1; PRSS14; TADG15; TMPRSS14

UniProt Protein Name

Suppressor of tumorigenicity 14 protein

UniProt Synonym Protein Names

Matriptase; Membrane-type serine protease 1; MT-SP1; Prostamin; Serine protease 14; Serine protease TADG-15; Tumor-associated differentially-expressed gene 15 protein

Protein Family

Suppressor of tumorigenicity 14 protein

UniProt Gene Name

ST14

UniProt Synonym Gene Names

PRSS14; SNC19; TADG15; MT-SP1

UniProt Entry Name

ST14_HUMAN

NCBI Protein Information

suppressor of tumorigenicity 14 protein; membrane-type serine protease 1; prostamin; serine protease 14; serine protease TADG-15; suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin); tumor associated differentially expressed gene 15 pr

UniProt Comments for MTSP1

ST14: Degrades extracellular matrix. Proposed to play a role in breast cancer invasion and metastasis. Exhibits trypsin-like activity as defined by cleavage of synthetic substrates with Arg or Lys as the P1 site. Defects in ST14 are a cause of ichthyosis autosomal recessive with hypotrichosis (ARIH). ARIH is a skin disorder characterized by congenital ichthyosis associated with the presence of less than the normal amount of hair. Belongs to the peptidase S1 family.

Protein type: EC 3.4.21.109; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 11q24-q25

Cellular Component: extrinsic to plasma membrane; extracellular space; integral to plasma membrane; basolateral plasma membrane; plasma membrane

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: keratinocyte differentiation; proteolysis

Disease: Ichthyosis, Congenital, Autosomal Recessive 11

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MTSP1 antibody

Reference Product	PubMed Publications
SPINT1 antibody	>27 publications with MTSP1 and SPINT1
HGF antibody	>8 publications with MTSP1 and HGF
CDCP1 antibody	>1 publications with MTSP1 and CDCP1

Pathways associated with anti-MTSP1 antibody

Products by Pathway	Pathway Diagram
MicroRNAs In Cancer Pathway antibodies	MicroRNAs In Cancer Pathway Diagram
MicroRNAs In Cancer Pathway antibodies	MicroRNAs In Cancer Pathway Diagram

Diseases associated with anti-MTSP1 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>55 publications with MTSP1 and Neoplasms
Congenital Abnormalities Antibodies	>35 publications with MTSP1 and Congenital Abnormalities
Breast Neoplasms Antibodies	>12 publications with MTSP1 and Breast Neoplasms
Disease Models, Animal Antibodies	>8 publications with MTSP1 and Disease Models, Animal
Inflammation Antibodies	>6 publications with MTSP1 and Inflammation
Neoplasms, Experimental Antibodies	>6 publications with MTSP1 and Neoplasms, Experimental
Prostatic Neoplasms Antibodies	>6 publications with MTSP1 and Prostatic Neoplasms
Respiratory Tract Diseases Antibodies	>5 publications with MTSP1 and Respiratory Tract Diseases
Immune System Diseases Antibodies	>5 publications with MTSP1 and Immune System Diseases
Kidney Diseases Antibodies	>5 publications with MTSP1 and Kidney Diseases

Organs/Tissues associated with anti-MTSP1 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>25 publications with MTSP1 and Blood
Skin Antibodies	>16 publications with MTSP1 and Skin
Kidney Antibodies	>11 publications with MTSP1 and Kidney
Intestine Antibodies	>11 publications with MTSP1 and Intestine
Bone Antibodies	>9 publications with MTSP1 and Bone
Muscle Antibodies	>9 publications with MTSP1 and Muscle
Embryonic Tissue Antibodies	>9 publications with MTSP1 and Embryonic Tissue
Lung Antibodies	>7 publications with MTSP1 and Lung
Prostate Antibodies	>6 publications with MTSP1 and Prostate
Liver Antibodies	>6 publications with MTSP1 and Liver