Mouse Anti-NDUFA2 Monoclonal Antibody – Cat# MBS6148423

Western Blot detection against Immunogen (36.63kD).

NDUFA2 Antibody – Mouse Monoclonal

Name: NDUFA2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6148423
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148423

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

NDUFA2, Monoclonal Antibody

Full Product Name

NDUFA2 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 2, Complex I-B8, CI-B8, NADH-ubiquinone Oxidoreductase B8 Subunit) (FITC)

Product Gene Name

anti-NDUFA2 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

6E7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human NDUFA2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

602137

3D Structure

ModBase 3D Structure for O43678

Immunogen

Partial recombinant corresponding to aa1-99 from human NDUFA2 (NP_002479) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Conjugate

FITC

Product Categories/Family for anti-NDUFA2 antibody

Antibodies; Enzymes; Dehydrogenase

Applications Tested/Suitable for anti-NDUFA2 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-NDUFA2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-NDUFA2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NDUFA2 purchase

MBS6148423 is an antibody targeting NDUFA2. Also known as NDUFA2 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 2, Complex I-B8, CI-B8, NADH-ubiquinone Oxidoreductase B8 Subunit) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NDUFA2. It may not necessarily be applicable to this product.

NCBI GI #

4505355

NCBI GeneID

4695

NCBI Accession #

NP_002479

UniProt Primary Accession #

O43678

UniProt Related Accession #

O43678

GenBank Nucleotide #

NM_002488

NCBI Official Full Name

NADH dehydrogenase

NCBI Official Synonym Full Names

NADH:ubiquinone oxidoreductase subunit A2

NCBI Official Symbol

NDUFA2

NCBI Official Synonym Symbols

B8; CD14; CIB8; MC1DN13

UniProt Protein Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

UniProt Synonym Protein Names

Complex I-B8; CI-B8; NADH-ubiquinone oxidoreductase B8 subunit

UniProt Gene Name

NDUFA2

UniProt Synonym Gene Names

CI-B8

UniProt Entry Name

NDUA2_HUMAN

NCBI Protein Information

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

NCBI Summary for NDUFA2

The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

UniProt Comments for NDUFA2

NDUFA2: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Protein type: EC 1.6.99.3; Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; Oxidoreductase; Mitochondrial

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Disease: Leigh Syndrome

Research Articles on NDUFA2

1. Review of a biorepository of patients with unsolved genetic leukoencephalopathies who underwent whole-exome or genome sequencing allowed us to identify a second patient with compound heterozygous mutations in NDUFA2. Only 1 other patient with mutations in NDUFA2 and a different phenotype (Leigh syndrome) has previously been reported. This is the first report of cystic leukoencephalopathy caused by mutations in NDUFA2.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NDUFA2 antibody

Reference Product	PubMed Publications
NDUFV2 antibody	>2 publications with NDUFA2 and NDUFV2
NDUFA7 antibody	>2 publications with NDUFA2 and NDUFA7
NDUFB8 antibody	>2 publications with NDUFA2 and NDUFB8
NDUFA6 antibody	>2 publications with NDUFA2 and NDUFA6

Pathways associated with anti-NDUFA2 antibody

Products by Pathway	Pathway Diagram
Alzheimer's Disease Pathway antibodies	Alzheimer's Disease Pathway Diagram
Alzheimer's Disease Pathway antibodies	Alzheimer's Disease Pathway Diagram
Electron Transport Chain Pathway antibodies	Electron Transport Chain Pathway Diagram
Huntington's Disease Pathway antibodies	Huntington's Disease Pathway Diagram
Huntington's Disease Pathway antibodies	Huntington's Disease Pathway Diagram
Metabolic Pathways antibodies	Metabolic Pathways Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway antibodies	NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway Diagram
NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway antibodies	NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway Diagram
Non-alcoholic Fatty Liver Disease (NAFLD) Pathway antibodies	Non-alcoholic Fatty Liver Disease (NAFLD) Pathway Diagram

Diseases associated with anti-NDUFA2 antibody

Disease Name	Pubmed Publications
Nervous System Diseases Antibodies	>2 publications with NDUFA2 and Nervous System Diseases
Leigh Disease Antibodies	>1 publications with NDUFA2 and Leigh Disease

Organs/Tissues associated with anti-NDUFA2 antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>2 publications with NDUFA2 and Muscle
Bone Antibodies	>1 publications with NDUFA2 and Bone
Blood Antibodies	>1 publications with NDUFA2 and Blood
Bone Marrow Antibodies	>1 publications with NDUFA2 and Bone Marrow
Skin Antibodies	>1 publications with NDUFA2 and Skin
Heart Antibodies	>1 publications with NDUFA2 and Heart